| Clone Name | rbaal21c16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYL_BURMA (Q62H20) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine-... | 35 | 0.20 | 2 | ENTK_MOUSE (P97435) Enteropeptidase (EC 3.4.21.9) (Enterokinase)... | 33 | 0.45 | 3 | SYL_BURPS (Q63QT6) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine-... | 33 | 0.58 | 4 | ATCU_VIBCH (Q9KPZ7) Copper-transporting P-type ATPase (EC 3.6.3.4) | 31 | 2.9 |
|---|
>SYL_BURMA (Q62H20) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 864 Score = 34.7 bits (78), Expect = 0.20 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Frame = -1 Query: 267 VTCTIWKIMGCPCQFGRLL-SPLRKNQALALHDSNLSTVLRVRSDIMSVIRVTHD 106 VT +WK++G +FG LL +P K AL + + VL+V + ++V D Sbjct: 770 VTFELWKVLGYADEFGPLLDAPWPKVDEAALEQAEIELVLQVNGKVRGALKVAKD 824
>ENTK_MOUSE (P97435) Enteropeptidase (EC 3.4.21.9) (Enterokinase) [Contains:| Enteropeptidase non-catalytic heavy chain; Enteropeptidase catalytic light chain] Length = 1069 Score = 33.5 bits (75), Expect = 0.45 Identities = 20/73 (27%), Positives = 34/73 (46%), Gaps = 1/73 (1%) Frame = -1 Query: 324 ITSLLHLSRSIERNIDQSPVTCTIWKIMGCPCQFGRLLSPLRKNQALALH-DSNLSTVLR 148 + +L H RS +R + + + + W + C + R L P R L LH SNL++ Sbjct: 844 VVALYHRDRSTDRLLCGASLVSSDWLVSAAHCVYRRNLDPTRWTAVLGLHMQSNLTSPQV 903 Query: 147 VRSDIMSVIRVTH 109 VR + ++ H Sbjct: 904 VRRVVDQIVINPH 916
>SYL_BURPS (Q63QT6) Leucyl-tRNA synthetase (EC 6.1.1.4) (Leucine--tRNA ligase)| (LeuRS) Length = 864 Score = 33.1 bits (74), Expect = 0.58 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 267 VTCTIWKIMGCPCQFGRLL-SPLRKNQALALHDSNLSTVLRVRSDIMSVIRVTHD 106 VT +WK +G +FG LL +P K AL + + VL+V + ++V D Sbjct: 770 VTFELWKALGYADEFGPLLDAPWPKVDEAALEQAEIELVLQVNGKVRGALKVAKD 824
>ATCU_VIBCH (Q9KPZ7) Copper-transporting P-type ATPase (EC 3.6.3.4)| Length = 915 Score = 30.8 bits (68), Expect = 2.9 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 7/67 (10%) Frame = -1 Query: 357 QRTVVSS**ACITSLLHLSRSIERNIDQSPVTCTIWKIMGCPC-------QFGRLLSPLR 199 Q T+++S + S + LS++ RN+ Q+ I+ +G P FG LLSP+ Sbjct: 825 QMTLLNSSPTSVVSAIELSKATLRNMKQNLFGAFIYNTLGIPIAAGVLYPAFGFLLSPVV 884 Query: 198 KNQALAL 178 A+AL Sbjct: 885 AGAAMAL 891 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,321,570 Number of Sequences: 219361 Number of extensions: 1599499 Number of successful extensions: 4096 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4093 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4872342800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)