| Clone Name | rbaal20m15 |
|---|---|
| Clone Library Name | barley_pub |
>VE1_HPV10 (P36720) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 681 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +1 Query: 49 KLECPAMKLLTDIVRRSEQRWEQV*SRYERITTLNP 156 +L+CP + + T+I +++RW+ + SR + T NP Sbjct: 588 QLKCPPLLITTNINPLTDERWKFLRSRLQLFTFKNP 623
>VE1_HPV27 (P36723) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 643 Score = 28.5 bits (62), Expect = 4.9 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 49 KLECPAMKLLTDIVRRSEQRWEQV*SRYERITTLNP 156 +L+CP + + T+I E RW+ + SR T NP Sbjct: 550 QLKCPPLMITTNINPLEEDRWKYLRSRLTLFTFNNP 585
>VE1_HPV29 (P50764) Replication protein E1 (EC 3.6.1.-) (ATP-dependent| helicase E1) Length = 660 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 49 KLECPAMKLLTDIVRRSEQRWEQV*SRYERITTLNPSAL 165 +L+CP + + T++ + RW+ + SR + T NP L Sbjct: 567 QLKCPPLLITTNVNPLEDDRWKYLRSRLQVFTFSNPCPL 605
>IF2M_SCHPO (O59683) Translation initiation factor IF-2, mitochondrial| precursor (IF-2Mt) (IF-2(Mt)) Length = 686 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 7 WRGMPIRGENIRPRKLECPAMKLLTDIVRRSEQR 108 W+ +PI G+ K E A ++L+DI R+S ++ Sbjct: 413 WKDLPIAGDLAYEVKSESEAKRILSDIYRQSNEQ 446
>COX17_PIG (P81045) Cytochrome c oxidase copper chaperone (Dopuin)| Length = 62 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 224 IVQNGEDAXXKWIXXHRQCLRAEGFNV 144 I++ GE+ I H++C+RA GF + Sbjct: 36 IIEKGEEHCGHLIEAHKECMRALGFKI 62
>COX17_MOUSE (P56394) Cytochrome c oxidase copper chaperone| Length = 62 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 224 IVQNGEDAXXKWIXXHRQCLRAEGFNV 144 I++ GE+ I H++C+RA GF + Sbjct: 36 IIEKGEEHCGHLIEAHKECMRALGFKI 62
>COX17_HUMAN (Q14061) Cytochrome c oxidase copper chaperone| Length = 62 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 224 IVQNGEDAXXKWIXXHRQCLRAEGFNV 144 I++ GE+ I H++C+RA GF + Sbjct: 36 IIEKGEEHCGHLIEAHKECMRALGFKI 62
>COX17_CANFA (Q6J3Q7) Cytochrome c oxidase copper chaperone| Length = 62 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 224 IVQNGEDAXXKWIXXHRQCLRAEGFNV 144 I++ GE+ I H++C+RA GF + Sbjct: 36 IIEKGEEHCGHLIEAHKECMRALGFKI 62
>PALA_SCHPO (Q09807) pH-response regulator protein palA/rim20| Length = 701 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 76 LTDIVRRSEQRWEQV*SRYERITTLNPSALKH 171 L +I+ R+E+R+ Q +RYE LN L+H Sbjct: 650 LYNIICRAEERYSQYENRYENENRLNKIKLQH 681 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,908,294 Number of Sequences: 219361 Number of extensions: 515406 Number of successful extensions: 1241 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1241 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)