| Clone Name | rbaal20g21 |
|---|---|
| Clone Library Name | barley_pub |
>UPPS_HELPY (P55984) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 234 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 268 WWRRAADIFIPPYLWLWHEPDDMTAIVVEFWQLFRELG 155 W A++F P LW P D+ I+ +F++ R+ G Sbjct: 193 WQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFG 230
>UPPS_HELPJ (Q9ZK05) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 234 Score = 30.0 bits (66), Expect = 3.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 268 WWRRAADIFIPPYLWLWHEPDDMTAIVVEFWQLFRELG 155 W A++F P LW P D+ I+ +F++ R+ G Sbjct: 193 WQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFG 230
>APC_RAT (P70478) Adenomatous polyposis coli protein (Protein APC)| Length = 2842 Score = 30.0 bits (66), Expect = 3.5 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Frame = -2 Query: 487 ASVXYAIRSACCAPRNPTSESWGIPSLKVGSSCGNSSHRSEDLRKDRPSEFGAP----PS 320 +S+ A +A C R +S+S I SLK G S G+ H + D + + P P Sbjct: 2112 SSLHQAAAAAACLSRQASSDSDSILSLKSGVSLGSPFHLTPDQEEKPFTSHKGPRILKPG 2171 Query: 319 RAFNIEAK 296 +EAK Sbjct: 2172 EKSTLEAK 2179
>APC_MOUSE (Q61315) Adenomatous polyposis coli protein (Protein APC) (mAPC)| Length = 2845 Score = 29.6 bits (65), Expect = 4.6 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -2 Query: 487 ASVXYAIRSACCAPRNPTSESWGIPSLKVGSSCGNSSHRSEDLRKDRP 344 +S+ A +A C R +S+S I SLK G S G+ H + D ++++P Sbjct: 2112 SSLHQAAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPD-QEEKP 2158
>MUTL_VIBF1 (Q5E2C6) DNA mismatch repair protein mutL| Length = 660 Score = 29.3 bits (64), Expect = 6.0 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -2 Query: 472 AIRSACCAPRNPTSESWGIPSLKVGSSCGNSSHRSEDLRKDRPSE 338 A+ S P +SW IP VGSS NS+ S D+P++ Sbjct: 382 AVESTPSYPNKAPLDSW-IPKGNVGSSSSNSTAPSRSFHTDKPTK 425 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,598,237 Number of Sequences: 219361 Number of extensions: 1271502 Number of successful extensions: 2948 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2948 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)