| Clone Name | rbaal20e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GTR10_HUMAN (O95528) Solute carrier family 2, facilitated glucos... | 32 | 2.4 | 2 | HRPK_PSESY (P41501) Pathogenicity locus protein hrpK | 30 | 9.0 | 3 | TRF5_YEAST (P48561) Poly(A) RNA polymerase protein 1 (EC 2.7.7.-... | 30 | 9.0 | 4 | FAAH_PIG (Q9TUI8) Fatty-acid amide hydrolase (EC 3.1.-.-) (Oleam... | 30 | 9.0 |
|---|
>GTR10_HUMAN (O95528) Solute carrier family 2, facilitated glucose transporter| member 10 (Glucose transporter type 10) Length = 541 Score = 31.6 bits (70), Expect = 2.4 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 411 LPHTNEQQRQMLLDFAQRTTPASSFNPPGASGGHITSESVPG 286 +P TNE QR+ +L A++T P P A S ++PG Sbjct: 356 IPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALSSALPG 397
>HRPK_PSESY (P41501) Pathogenicity locus protein hrpK| Length = 641 Score = 29.6 bits (65), Expect = 9.0 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = -1 Query: 498 RMQASGS-VIGSEASQATSREMPVE--LLRASLPHTNEQQRQMLLDFAQRTTPASSFNPP 328 R+ +S S +GS +Q TS E+ E L +ASL + Q + F Q SSF+ Sbjct: 2 RISSSPSPALGSIVNQPTSGELAAETPLAKASLTQSGAGGGQAFVQFGQANDSPSSFSGT 61 Query: 327 GASGGHITS 301 SG + S Sbjct: 62 EQSGSSLMS 70
>TRF5_YEAST (P48561) Poly(A) RNA polymerase protein 1 (EC 2.7.7.-)| (Topoisomerase 1-related protein TRF5) Length = 625 Score = 29.6 bits (65), Expect = 9.0 Identities = 19/82 (23%), Positives = 37/82 (45%), Gaps = 2/82 (2%) Frame = -1 Query: 648 DRATELLTDQHAVSSYTSSNRALWQASFDAFFGLLTKYCLSKYESILQMFRMQASGSV-- 475 +R++ LLTD+H VS TS +++ + + + +C SK I + V Sbjct: 127 ERSSFLLTDEHEVSKLTSQQSLNTESACNVEYPWIRNHCHSKQRRIADWLTSEIKDFVHY 186 Query: 474 IGSEASQATSREMPVELLRASL 409 I ++ R ++ LR ++ Sbjct: 187 ISPSKNEIKCRNRTIDKLRRAV 208
>FAAH_PIG (Q9TUI8) Fatty-acid amide hydrolase (EC 3.1.-.-) (Oleamide| hydrolase) (Anandamide amidohydrolase) Length = 579 Score = 29.6 bits (65), Expect = 9.0 Identities = 37/131 (28%), Positives = 55/131 (41%), Gaps = 13/131 (9%) Frame = -1 Query: 666 IIKSVLDRATELLTDQHAVSSYTSSNRA-LWQASFDAFFGLLTKYCLSKYESILQMFRMQ 490 ++ S L +A E+ + V++Y + A L QA GLL +S + + F + Sbjct: 96 VLFSYLQKAWEVNRGTNCVTTYLADCEAQLCQAPGQ---GLLYGVPVS----LKECFSCK 148 Query: 489 ASGSVIGSEASQATSRE-----MPVELLRASLP--HTNEQQRQMLLD-----FAQRTTPA 346 S +G +Q T E + V L+ ++P HTN Q D F Q T P Sbjct: 149 GHDSTLGLSRNQGTPAECDCVVVQVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTTNPW 208 Query: 345 SSFNPPGASGG 313 S PG S G Sbjct: 209 MSSKSPGGSSG 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,756,640 Number of Sequences: 219361 Number of extensions: 1978545 Number of successful extensions: 4412 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4411 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)