| Clone Name | rbaal20d17 |
|---|---|
| Clone Library Name | barley_pub |
>CRD1_HORVU (Q5EFU4) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Protein Xantha-l) Length = 417 Score = 82.0 bits (201), Expect = 4e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -3 Query: 201 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 76 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV Sbjct: 365 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 406
>CRD1_GOSHI (Q6SJV8) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 68.6 bits (166), Expect = 4e-12 Identities = 30/42 (71%), Positives = 39/42 (92%) Frame = -3 Query: 201 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 76 +++GE++D+PLVKNLKR+PLIA L SE++A YLMPPIESGSV Sbjct: 353 LAVGETSDIPLVKNLKRIPLIAALASELLATYLMPPIESGSV 394
>CRD1_EUPES (Q945B7) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 405 Score = 65.5 bits (158), Expect = 4e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 198 SIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 76 ++GE+ D +VKNLKRVPLIA LVSEI+AAYLMPPIESGSV Sbjct: 354 AVGETEDNSVVKNLKRVPLIAALVSEILAAYLMPPIESGSV 394
>CRD1_ARATH (Q9M591) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase, chloroplast precursor (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) (Copper response defect 1 protein) (Dicarboxylate diiron protein) (AtZIP Length = 409 Score = 60.8 bits (146), Expect = 9e-10 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 201 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 76 ++IGE++D +K LKR+PL+ L SEI+AAYLMPP+ESGSV Sbjct: 357 LAIGETDDASFIKTLKRIPLVTSLASEILAAYLMPPVESGSV 398
>ACSF_PORPU (P51277) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase) Length = 349 Score = 33.9 bits (76), Expect = 0.12 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = -3 Query: 201 ISIGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSV 76 I I + PLVK + PL L+ +I YL+ PI+S +V Sbjct: 303 IDIDKKGSQPLVKTFMKAPLYMSLILNLIKIYLIKPIDSQAV 344
>ACSF1_ANASP (Q8YX57) Magnesium-protoporphyrin IX monomethyl ester [oxidative]| cyclase 1 (EC 1.14.13.81) (Mg-protoporphyrin IX monomethyl ester oxidative cyclase 1) Length = 351 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = -3 Query: 195 IGESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIES 85 I S+ VK ++++PLIA +V ++ YL+ PI++ Sbjct: 307 IERSSQPKFVKLIRKLPLIAAIVWNLLMVYLIKPIDT 343
>PT1_BUCAI (Q9WXI6) Phosphoenolpyruvate-protein phosphotransferase (EC| 2.7.3.9) (Phosphotransferase system, enzyme I) Length = 571 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = -3 Query: 189 ESNDLPLVKNLKRVPLIAQLVSEIIAAYLMPPIESGSVILPNLAQACLLICR 34 ++N++P KN+K +I S IIA YL+ ++ S+ +L Q L + R Sbjct: 414 KNNNIPFDKNIKIGIMIETPASAIIAEYLIKEVDFFSIGTNDLTQYTLAVDR 465
>CTR3_MOUSE (P70423) Cationic amino acid transporter 3 (CAT-3) (Solute carrier| family 7 member 3) (Cationic amino acid transporter y+) Length = 618 Score = 29.3 bits (64), Expect = 2.9 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 9/57 (15%) Frame = -3 Query: 177 LPLVKNLKRVPLIAQLVSEIIAAY---------LMPPIESGSVILPNLAQACLLICR 34 L V ++ +P++A LVS +IAA+ L+ + G+++ +L C+LI R Sbjct: 373 LAKVHSVTHIPIVATLVSGVIAAFMAFLFELTDLVDLMSIGTLLAHSLVSICVLILR 429
>KCNG1_HUMAN (Q9UIX4) Potassium voltage-gated channel subfamily G member 1| (Voltage-gated potassium channel subunit Kv6.1) (kH2) Length = 513 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 199 FYRRVQRLAPGEEPEEG 149 FYRR QRL P +EP +G Sbjct: 39 FYRRAQRLRPQDEPRQG 55
>DNAK_PSESM (Q87WP0) Chaperone protein dnaK (Heat shock protein 70) (Heat shock| 70 kDa protein) (HSP70) Length = 638 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 201 ISIGESNDLPLVKNLKRVPLIAQLVSE 121 I IG+ ND+ LV R+PL+ +LV+E Sbjct: 329 IDIGKINDVILVGGQTRMPLVQKLVTE 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,206,911 Number of Sequences: 219361 Number of extensions: 421615 Number of successful extensions: 1254 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1254 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)