| Clone Name | rbaal20c17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 29 | 2.6 | 2 | IFRD1_MOUSE (P19182) Interferon-related developmental regulator ... | 28 | 5.8 | 3 | RNAS1_MICNV (Q9WUV3) Ribonuclease pancreatic precursor (EC 3.1.2... | 28 | 7.5 |
|---|
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 29.3 bits (64), Expect = 2.6 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = -1 Query: 197 SKHVRTYVRRRTALAMHITHANVRTRMEHLLFXRWIGSP 81 ++H+RTY R T LA H+ ++ RME W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350
>IFRD1_MOUSE (P19182) Interferon-related developmental regulator 1 (Nerve growth| factor-inducible protein PC4) (TPA-induced sequence 7) (TIS7 protein) Length = 449 Score = 28.1 bits (61), Expect = 5.8 Identities = 11/40 (27%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = +1 Query: 142 VICM-ASAVRRRTYVRTCLLLCSYLDTGERPQIHNNLKCF 258 +IC A++++ R TC +C ++ T + ++++ L+CF Sbjct: 174 IICDGAASIQARQTCATCFGVCCFIATDDITELYSTLECF 213
>RNAS1_MICNV (Q9WUV3) Ribonuclease pancreatic precursor (EC 3.1.27.5) (RNase 1)| (RNase A) Length = 148 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -2 Query: 214 QGSCTKVSTYVRTYDDALHLPCISRMQTYXHAWNICYSFDGSGLLTVC 71 QG C V+T+V A+H C + T + + CY + +T C Sbjct: 61 QGYCKPVNTFVHEPQTAVHAVCSQKNVTCKNGNSNCYKSHSALHITDC 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,469,523 Number of Sequences: 219361 Number of extensions: 739351 Number of successful extensions: 1362 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1362 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)