| Clone Name | rbaal7e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FKBP9_MOUSE (Q9Z247) FK506-binding protein 9 precursor (EC 5.2.1... | 30 | 8.3 | 2 | BCSA_SALTY (Q93IN2) Cellulose synthase catalytic subunit [UDP-fo... | 30 | 8.3 | 3 | BCSA_SALTI (Q8Z291) Cellulose synthase catalytic subunit [UDP-fo... | 30 | 8.3 |
|---|
>FKBP9_MOUSE (Q9Z247) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS) Length = 570 Score = 29.6 bits (65), Expect = 8.3 Identities = 20/59 (33%), Positives = 31/59 (52%) Frame = -1 Query: 225 VISPG*PLHMPVILASLWSLNPSIH*YTVV*ISPTSCTRGQLTVKLTGNFIQIYHVNIT 49 VI P LH V+L +W+ +H T P SC R T++++ +F++ YH N T Sbjct: 125 VIPPNSVLHFDVLLVDIWNSEDQVHIQTY--FKPPSCPR---TIQVS-DFVR-YHYNGT 176
>BCSA_SALTY (Q93IN2) Cellulose synthase catalytic subunit [UDP-forming] (EC| 2.4.1.12) Length = 874 Score = 29.6 bits (65), Expect = 8.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 539 IMTPGQEGLLENSRGYIRLGQSQGFLALKCFWTVQRW 429 ++ P L E +GY R G S AL C WT+ W Sbjct: 9 LIPPVSARLSERYQGYRRHGASPFSAALGCLWTILAW 45
>BCSA_SALTI (Q8Z291) Cellulose synthase catalytic subunit [UDP-forming] (EC| 2.4.1.12) Length = 874 Score = 29.6 bits (65), Expect = 8.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 539 IMTPGQEGLLENSRGYIRLGQSQGFLALKCFWTVQRW 429 ++ P L E +GY R G S AL C WT+ W Sbjct: 9 LIPPVSARLSERYQGYRRHGASPFSAALGCLWTILAW 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,261,571 Number of Sequences: 219361 Number of extensions: 1825623 Number of successful extensions: 3802 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3802 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)