| Clone Name | rbaal19n06 |
|---|---|
| Clone Library Name | barley_pub |
>AXN2_RAT (O70240) Axin-2 (Axis inhibition protein 2) (Conductin) (Axin-like| protein) (Axil) Length = 838 Score = 32.3 bits (72), Expect = 1.3 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 398 CIRTAQLTTPPEQ-CCYTEMEEQHAHPVKGQTGRTAY 291 C R A+++ P +Q CC + HP GQ G T++ Sbjct: 696 CRRLAEVSKPQKQRCCVASQQRDRNHPATGQAGPTSF 732
>NADB_PYRAB (Q9V2R0) L-aspartate oxidase (EC 1.4.3.16) (LASPO) (Quinolinate| synthetase B) Length = 464 Score = 30.4 bits (67), Expect = 5.1 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 9/49 (18%) Frame = -2 Query: 347 EMEEQHAHP----VKGQTGRTAYPVKERTGREMAV-----VTDQVGLFN 228 E+E H+HP +K +TG+ P+ E+ RE+ V +++G+ N Sbjct: 103 ELEGGHSHPRVFTIKSETGKHVIPILEKHARELGVNFVRGFVEEIGIKN 151
>RS17_MYCPA (Q73SA5) 30S ribosomal protein S17| Length = 117 Score = 30.4 bits (67), Expect = 5.1 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -2 Query: 347 EMEEQHAHPVKGQTGRTAYPVKERTGREMAVVTDQVGLFNLTPT 216 E+E++ HP+ G+ RT VK +A + D+V L PT Sbjct: 58 ELEDRVKHPLYGKIIRTTKKVKAHDENSIAGIGDRVSLMETRPT 101
>AXN2_HUMAN (Q9Y2T1) Axin-2 (Axis inhibition protein 2) (Conductin) (Axin-like| protein) (Axil) Length = 843 Score = 30.4 bits (67), Expect = 5.1 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 398 CIRTAQLTTPPEQ-CCYTEMEEQHAHPVKGQTGRTAY 291 C R A+++ PP+Q CC + H QTG T + Sbjct: 701 CRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPF 737
>RX_HUMAN (Q9Y2V3) Retinal homeobox protein Rx (Retina and anterior neural| fold homeobox protein) Length = 346 Score = 30.4 bits (67), Expect = 5.1 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -3 Query: 523 IQPRAPGPATIPSGSGWGCRLLCERLGPRAESHGFKRL---IHGHAFGQP 383 +QP AP P + P G G+G + + PR S RL H A G+P Sbjct: 293 LQPLAPPPPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKP 342
>NCOA1_MOUSE (P70365) Nuclear receptor coactivator 1 (EC 2.3.1.48) (NCoA-1)| (Steroid receptor coactivator 1) (SRC-1) (Nuclear receptor coactivator protein 1) (mNRC-1) Length = 1447 Score = 30.4 bits (67), Expect = 5.1 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 263 SRGQFFLSLDMLFFQFVPSLDVHAVLPSLCSSTAQEES*AGLS 391 S+ QF LD F Q +P+L+ A LPSLC + + + G+S Sbjct: 809 SQSQFTADLDQ-FDQLLPTLEKAAQLPSLCETDRMDGAVTGVS 850
>RS17_NOCFA (Q5Z1V4) 30S ribosomal protein S17| Length = 89 Score = 30.0 bits (66), Expect = 6.6 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -2 Query: 347 EMEEQHAHPVKGQTGRTAYPVKERTGREMAVVTDQVGLFNLTP 219 E+E++ HP+ G+ RT VK E+A V D+V L P Sbjct: 30 ELEDRVKHPLYGKIIRTTSKVKAHDENEIAGVGDRVQLMETRP 72
>JIP3_HUMAN (Q9UPT6) C-jun-amino-terminal kinase-interacting protein 3| (JNK-interacting protein 3) (JIP-3) (JNK MAP kinase scaffold protein 3) (Mitogen-activated protein kinase 8-interacting protein 3) Length = 1334 Score = 30.0 bits (66), Expect = 6.6 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +3 Query: 432 SARGPSRSQSSLHPHPDPDGMVAGPGARGWIVRWKRPPSSW 554 S GP SS P P+P G G G+ W + W Sbjct: 937 SENGPEPDSSSTRPEPEPSGDPTGAGSSAAPTMWLGAQNGW 977
>TLR9_CANFA (Q5I2M8) Toll-like receptor 9 precursor (CD289 antigen)| Length = 1032 Score = 30.0 bits (66), Expect = 6.6 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 14/62 (22%) Frame = +3 Query: 243 LIGDDSHLAASSFFHWICCSSSL----------SLHWMC----MLFFHLCVAALLRRSRE 380 + D L W+C S SL LH +C FHLC+A L RR R Sbjct: 803 IFAQDLRLCLDEALSWVCFSLSLLAVALSLAVPMLHQLCGWDLWYCFHLCLAWLPRRGRR 862 Query: 381 LG 386 G Sbjct: 863 RG 864 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,476,931 Number of Sequences: 219361 Number of extensions: 2377000 Number of successful extensions: 7845 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 7461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7842 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)