| Clone Name | rbaal19n05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEU2_BUCUS (Q9EVI3) 3-isopropylmalate dehydratase large subunit ... | 31 | 3.6 | 2 | LEU2_BUCUA (Q9EVG5) 3-isopropylmalate dehydratase large subunit ... | 31 | 4.7 |
|---|
>LEU2_BUCUS (Q9EVI3) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) (Fragment) Length = 442 Score = 31.2 bits (69), Expect = 3.6 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +2 Query: 344 NMEEKTLTYKRLIQVIKYHEEKSSS--ILLQSKTYLTNSSLSTIGSSLYTSANSGDL--- 508 +++EK Y + IK KS+ + LQS TYLTN S+ + T+A DL Sbjct: 299 SIDEKIPDYNNINSAIKRESSKSACEYMGLQSNTYLTNISIDRVFIGSCTNARIEDLRSA 358 Query: 509 -DMLKSFKI 532 +LK+ KI Sbjct: 359 SKILKNKKI 367
>LEU2_BUCUA (Q9EVG5) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) (Fragment) Length = 443 Score = 30.8 bits (68), Expect = 4.7 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +2 Query: 344 NMEEKTLTYKRLIQVIKYHEEKSSS--ILLQSKTYLTNSSLSTIGSSLYTSANSGDL 508 +++EK Y + ++K KS+ + LQS TYLTN S+ + T+A DL Sbjct: 299 SIDEKIPDYNNINSIVKRKSAKSACEYMGLQSNTYLTNISIDKVFIGSCTNARIEDL 355 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,063,911 Number of Sequences: 219361 Number of extensions: 1898777 Number of successful extensions: 3498 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3498 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7932903580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)