| Clone Name | rbaal19k12 |
|---|---|
| Clone Library Name | barley_pub |
>ENV_SIVSP (P19503) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 889 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 63 KMLPKCRCREANDPRSXAPNIAGTPAPSSTQRYAAXGTTRP 185 K+ P C N + + GTPAP++TQ +T P Sbjct: 103 KLTPLCITMRCNKSETDRWGLTGTPAPTTTQTTTTQASTTP 143
>MINT_HUMAN (Q96T58) Msx2-interacting protein (SPEN homolog)| (SMART/HDAC1-associated repressor protein) Length = 3664 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 72 PKCRCREANDPRSXAPNIAGTPAPSSTQRYAAXGTTRPPGT 194 P + EAN+P++ P+ P + Q+ A ++PP + Sbjct: 1762 PAQKSEEANEPKAEKPDATADAEPDANQKAEAAPESQPPAS 1802
>2A5N_ARATH (Q9LU89) Serine/threonine protein phosphatase 2A 59 kDa regulatory| subunit B' eta isoform (PP2A, B' subunit, eta isoform) (AtB' eta) Length = 510 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 177 LSXXQHIFESSSGPEFQQCSVPYF 106 L+ + + E++ PEFQ+C VP F Sbjct: 373 LNELEEVLEATQPPEFQRCMVPLF 396
>SEM4C_MOUSE (Q64151) Semaphorin-4C precursor (Semaphorin I) (Sema I)| (Semaphorin C-like 1) (M-Sema F) Length = 834 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 63 KMLP-KCRCREANDPRSXAPNIAGTPAPSSTQRYAAXG 173 K++P RC+ P S P I G P PS T+ + G Sbjct: 745 KIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGG 782
>2A5T_ARATH (Q8LF36) Serine/threonine protein phosphatase 2A 57 kDa regulatory| subunit B' theta isoform (PP2A, B' subunit, theta isoform) (AtB' theta) Length = 492 Score = 28.1 bits (61), Expect = 6.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 177 LSXXQHIFESSSGPEFQQCSVPYF 106 L+ + + E++ PEFQ+C VP F Sbjct: 352 LNELEEVLEATQPPEFQRCMVPLF 375
>SEM4C_HUMAN (Q9C0C4) Semaphorin-4C precursor| Length = 833 Score = 28.1 bits (61), Expect = 6.6 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 63 KMLP-KCRCREANDPRSXAPNIAGTPAPSSTQRYAAXG 173 K++P RC+ P S P I G P PS T+ + G Sbjct: 744 KIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGGG 781
>BAS1_YEAST (P22035) Myb-like DNA-binding protein BAS1| Length = 811 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +3 Query: 108 SXAPNIAGT--PAPSSTQRYAAXGTTRPP 188 S +PN GT APSST Y G+ PP Sbjct: 589 SMSPNFNGTNGKAPSSTASYTTSGSEMPP 617 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,884,343 Number of Sequences: 219361 Number of extensions: 388190 Number of successful extensions: 965 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 965 length of database: 80,573,946 effective HSP length: 40 effective length of database: 71,799,506 effective search space used: 1723188144 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)