| Clone Name | rbaal7d17 |
|---|---|
| Clone Library Name | barley_pub |
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 158 PSDLIQRFHSPLPLSAPSPFKNQPISRAMSQTVELRVGMSCE 33 P+D + HS L L AP F+++P + L +G S + Sbjct: 797 PADAVHEIHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQ 838
>HMEN_ARTSF (Q05640) Homeobox protein engrailed| Length = 349 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 155 SDLIQRFHSPLPLS--APSPFKNQPISRAMSQTVELRVGMSCEGCVGAV 15 S+L +R+ P PLS P P ++P S MS + G+S + + + Sbjct: 19 SNLTERYDGPSPLSASTPGPSPDRPGSATMSSPLSSPTGISYQSLLSGI 67
>ATOX1_MOUSE (O08997) Copper transport protein ATOX1 (Metal transport protein| ATX1) Length = 68 Score = 28.1 bits (61), Expect = 6.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 59 ELRVGMSCEGCVGAVKRVL 3 E V M+CEGC AV RVL Sbjct: 5 EFSVDMTCEGCAEAVSRVL 23
>ATOX1_CANFA (Q9TT99) Copper transport protein ATOX1 (Metal transport protein| ATX1) Length = 68 Score = 28.1 bits (61), Expect = 6.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 59 ELRVGMSCEGCVGAVKRVL 3 E V M+CEGC AV RVL Sbjct: 5 EFSVDMTCEGCSNAVSRVL 23
>AHM7_ARATH (Q9SH30) Putative copper-transporting ATPase 3 (EC 3.6.3.4)| Length = 995 Score = 28.1 bits (61), Expect = 6.8 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 95 NQPISRAMSQTVELRVGMSCEGCVGAVKRVL 3 + PISRA+ Q + GM+C C G+V++ + Sbjct: 47 DDPISRAVFQVL----GMTCSACAGSVEKAI 73
>ATOX1_SHEEP (Q9XT28) Copper transport protein ATOX1 (Metal transport protein| ATX1) (Copper chaperone SAH) Length = 68 Score = 27.7 bits (60), Expect = 8.9 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 59 ELRVGMSCEGCVGAVKRVL 3 E V M+CEGC AV RVL Sbjct: 5 EFSVDMTCEGCSNAVTRVL 23
>ATCU_VIBCH (Q9KPZ7) Copper-transporting P-type ATPase (EC 3.6.3.4)| Length = 915 Score = 27.7 bits (60), Expect = 8.9 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 95 NQPISRAMSQTVELRV-GMSCEGCVGAVKRVL 3 N + A SQT+ L + GM+C CV +V++ L Sbjct: 163 NTEATEASSQTLSLLIKGMTCASCVASVEKAL 194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,981,681 Number of Sequences: 219361 Number of extensions: 207092 Number of successful extensions: 1008 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1007 length of database: 80,573,946 effective HSP length: 30 effective length of database: 73,993,116 effective search space used: 1775834784 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)