| Clone Name | rbaal19f16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GATB_SYNEL (Q8DGC4) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransfe... | 28 | 4.3 | 2 | CALX2_ARATH (Q38798) Calnexin homolog 2 precursor | 28 | 7.4 |
|---|
>GATB_SYNEL (Q8DGC4) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B| (EC 6.3.5.-) (Asp/Glu-ADT subunit B) Length = 500 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -3 Query: 213 QYRSSRVQFQGI---EFQKKSEGDEAPKLVSSGLVEKSRP 103 QYR+ + + QG + KKS G PKL + L +K P Sbjct: 459 QYRAGKTKLQGFFVGQLMKKSGGRADPKLANQLLAQKLNP 498
>CALX2_ARATH (Q38798) Calnexin homolog 2 precursor| Length = 532 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -3 Query: 204 SSRVQFQGIEFQKKSEG-DEAPKLVSSGLVEKSRPYGIV 91 S + ++QG+ +KSEG D+ LVS EK++ YGIV Sbjct: 46 SEKAEYQGVWKHEKSEGHDDYGLLVS----EKAKKYGIV 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,847,485 Number of Sequences: 219361 Number of extensions: 657485 Number of successful extensions: 1934 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1902 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1934 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)