| Clone Name | rbaal19f14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OCLN_CANFA (Q28269) Occludin | 31 | 2.4 | 2 | Y24K_STRGR (P12752) Hypothetical 24.7 kDa protein in photolyase ... | 30 | 4.1 | 3 | OFUT1_CAEEL (Q18014) Putative GDP-fucose protein O-fucosyltransf... | 30 | 4.1 | 4 | YL671_MIMIV (Q5UNT3) Hypothetical protein L671 | 30 | 5.3 | 5 | ATL1O_ARATH (Q8LFY8) RING-H2 finger protein ATL1O (RING-H2 finge... | 29 | 9.1 | 6 | FOXO4_HUMAN (P98177) Putative fork head domain transcription fac... | 29 | 9.1 |
|---|
>OCLN_CANFA (Q28269) Occludin| Length = 521 Score = 31.2 bits (69), Expect = 2.4 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Frame = +2 Query: 380 LKWSSSAR*DHKVLL--AAYAATPCPE----LRCSESG*FWRAPAPARRGHQRPPAPWVP 541 + +SS+ + + K L ++Y +TP PE L + +R P + GH PP+ P Sbjct: 322 MAYSSNGKVNDKRLYPESSYKSTPVPEVVQELPATSPADDFRQPRYSSSGHLEPPSKRAP 381 Query: 542 GRAHTVRPR 568 + T RP+ Sbjct: 382 SKGRTGRPK 390
>Y24K_STRGR (P12752) Hypothetical 24.7 kDa protein in photolyase 5'region| Length = 238 Score = 30.4 bits (67), Expect = 4.1 Identities = 20/55 (36%), Positives = 23/55 (41%), Gaps = 5/55 (9%) Frame = +2 Query: 443 PCPELRC---SESG*FWRA--PAPARRGHQRPPAPWVPGRAHTVRPRTCPCGVSC 592 PC R + S WR PAP R G RPP P + + RPR C C Sbjct: 2 PCTHCRTPNGTSSSATWRTARPAPRRCGSCRPPPP--GSASPSPRPRRASCATGC 54
>OFUT1_CAEEL (Q18014) Putative GDP-fucose protein O-fucosyltransferase 1| precursor (EC 2.4.1.221) (Peptide-O-fucosyltransferase) (O-FucT-1) Length = 389 Score = 30.4 bits (67), Expect = 4.1 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +2 Query: 278 PPPDHQIASWSGSPCPAPSIKSIYSNHQR*EKKFLKWSSSAR*DHKVLLAAYAATP 445 P ++ + ++S +P P PS ++S +K+L+WSS K ++A A P Sbjct: 183 PSEEYPVLAFSSAPAPFPSKGKVWSI-----QKYLRWSSRITEQAKKFISANLAKP 233
>YL671_MIMIV (Q5UNT3) Hypothetical protein L671| Length = 152 Score = 30.0 bits (66), Expect = 5.3 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = -3 Query: 224 IGRSTDGS*GCDLIFFPAFVVSPRPHFCLVETQLSMSCSYIWLETTLLCITC 69 IG T+G C I P F +E + + C YI +T ++C+ C Sbjct: 14 IGLETNGKFWCKFI-------GPNKFFICLEGEFEILCDYIVAQTGIICLDC 58
>ATL1O_ARATH (Q8LFY8) RING-H2 finger protein ATL1O (RING-H2 finger protein| ATL11) Length = 413 Score = 29.3 bits (64), Expect = 9.1 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 9/33 (27%) Frame = +2 Query: 278 PPPDH-----QIASWSGSP----CPAPSIKSIY 349 P PD+ Q+ WS SP CP+PSI ++Y Sbjct: 38 PEPDYYTISPQLPPWSSSPQPSPCPSPSISAVY 70
>FOXO4_HUMAN (P98177) Putative fork head domain transcription factor AFX1| (Forkhead box protein O4) Length = 505 Score = 29.3 bits (64), Expect = 9.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 266 GSTPPPPDHQIASWSGSPC 322 G+TP P A WSGSPC Sbjct: 225 GATPTSPVGHFAKWSGSPC 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,206,598 Number of Sequences: 219361 Number of extensions: 2129911 Number of successful extensions: 5820 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5805 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5253413348 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)