| Clone Name | rbaal19f13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HXT1_YEAST (P32465) Low-affinity glucose transporter HXT1 | 28 | 7.2 | 2 | T3MO_ECOLI (P12364) Type III restriction-modification system Eco... | 28 | 7.2 |
|---|
>HXT1_YEAST (P32465) Low-affinity glucose transporter HXT1| Length = 570 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 346 LSDQAMTALTFDIGIIHXFSICCIIYAI 263 LSD T++ F G+++ FS CC +Y + Sbjct: 356 LSDSFETSIVF--GVVNFFSTCCSLYTV 381
>T3MO_ECOLI (P12364) Type III restriction-modification system EcoP15I enzyme| mod (EC 2.1.1.72) (EcoP15I methyltransferase) (M.EcoP15I) Length = 645 Score = 27.7 bits (60), Expect = 7.2 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -3 Query: 135 IQARNHS*LLSQQSYNF--VKNLDVRVSEKFSSPY*GNK 25 + +N L+S+ N VKNL V + E+F+S Y GN+ Sbjct: 246 VYTKNKEQLISEWKSNISDVKNLLVNIGEEFASKYTGNE 284 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,343,413 Number of Sequences: 219361 Number of extensions: 502000 Number of successful extensions: 830 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)