| Clone Name | rbaal19f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FCR1_CANAL (O93870) Fluconazole resistance protein 1 | 30 | 3.9 | 2 | VG82_BPML5 (Q05298) Gene 82 protein (Gp82) | 30 | 5.0 | 3 | SYN3_HUMAN (O14994) Synapsin-3 (Synapsin III) | 29 | 8.6 |
|---|
>FCR1_CANAL (O93870) Fluconazole resistance protein 1| Length = 517 Score = 30.4 bits (67), Expect = 3.9 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -3 Query: 517 GSLPCGKIKV---VCSVLPEDNSEGNGKHPSGHVLLFDSRAEKMPVSEDGYLDLSR 359 G PC + + +C V E KHPSG+V L ++R + + S + ++LSR Sbjct: 38 GKKPCNRCTLDNKIC-VFTEKKKTKEKKHPSGYVELLEARLDILTRSLEKLIELSR 92
>VG82_BPML5 (Q05298) Gene 82 protein (Gp82)| Length = 126 Score = 30.0 bits (66), Expect = 5.0 Identities = 22/69 (31%), Positives = 31/69 (44%) Frame = -3 Query: 469 EDNSEGNGKHPSGHVLLFDSRAEKMPVSEDGYLDLSRQVVSVKSGGRLEIRMQAGDFSGS 290 E + +G H SGHVLL ++ P D R+VV G L I + DF GS Sbjct: 31 EGDFKGRVIHRSGHVLLAHAKGVVRPAGRDKVRRERRKVVHAGIVGEL-ISLLPQDFVGS 89 Query: 289 VVFPSKFSN 263 + + + N Sbjct: 90 KIAYNPYEN 98
>SYN3_HUMAN (O14994) Synapsin-3 (Synapsin III)| Length = 580 Score = 29.3 bits (64), Expect = 8.6 Identities = 19/76 (25%), Positives = 33/76 (43%) Frame = -3 Query: 439 PSGHVLLFDSRAEKMPVSEDGYLDLSRQVVSVKSGGRLEIRMQAGDFSGSVVFPSKFSNI 260 P G R + V +D + D S+ K G +EIR++ ++FS + Sbjct: 80 PPGPSTPIVQRPRILLVIDDAHTDWSKYFHGKKVNGEIEIRVE----------QAEFSEL 129 Query: 259 SQKGFELGGCKVEINV 212 + + GGC V++ V Sbjct: 130 NLAAYVTGGCMVDMQV 145 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,890,149 Number of Sequences: 219361 Number of extensions: 1590743 Number of successful extensions: 3409 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3409 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)