| Clone Name | rbaal19d15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y417_CHLTR (O84422) Probable metal transport system membrane pro... | 29 | 7.5 |
|---|
>Y417_CHLTR (O84422) Probable metal transport system membrane protein CT_417| Length = 293 Score = 29.3 bits (64), Expect = 7.5 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 7/71 (9%) Frame = -3 Query: 273 EMLMVVNIDLQGSSFRALSFRKSLKGMKHQSLFRQGLL-------KSLVLMASITAIIQL 115 ++ +V + + + F AL F + + H S+ LL ++VLM + I+ L Sbjct: 150 DLFIVATVSICHTRFLALCFDEKYMALNHYSIKTWYLLLLILTAITTVVLMYVMGVILML 209 Query: 114 TQAMLPLSLDC 82 + +LP+S+ C Sbjct: 210 SMLVLPVSIAC 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,242,202 Number of Sequences: 219361 Number of extensions: 1104361 Number of successful extensions: 3098 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3096 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)