| Clone Name | rbaal19d07 |
|---|---|
| Clone Library Name | barley_pub |
>PRDM2_HUMAN (Q13029) PR domain zinc finger protein 2 (PR domain-containing| protein 2) (Retinoblastoma protein-interacting zinc-finger protein) (Zinc finger protein RIZ) (MTE-binding protein) (MTB-ZF) (GATA-3-binding protein G3B) Length = 1718 Score = 30.8 bits (68), Expect = 0.98 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 34 CYKLYKDITGKEKHRYPIVQLHNIYIADQCSDNIVFL 144 C +L+KD T +HR+ + + NI++ C FL Sbjct: 1167 CVQLFKDKTDLSEHRFLLHGVGNIFVCSVCKKEFAFL 1203
>MUTL_XYLFT (Q87AC9) DNA mismatch repair protein mutL| Length = 619 Score = 30.4 bits (67), Expect = 1.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 79 YPIVQLHNIYIADQCSDNIVFLI*HA 156 Y I QLH IYI +C+D ++ + HA Sbjct: 431 YAIAQLHGIYILAECADGLIVVDMHA 456
>MUTL_XYLFA (Q9PFB8) DNA mismatch repair protein mutL| Length = 619 Score = 30.4 bits (67), Expect = 1.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 79 YPIVQLHNIYIADQCSDNIVFLI*HA 156 Y I QLH IYI +C+D ++ + HA Sbjct: 431 YAIAQLHGIYILAECADGLIVVDMHA 456
>LEU3_AQUAE (O66607) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 364 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 28 VECYKLYKDITGKEKHRYPIVQLHNIYIADQCSDNIV 138 +E L++ I +EK YP V+L ++YI D C+ +V Sbjct: 196 LEVSALWRQIVEEEKENYPDVELEHLYI-DNCAMQLV 231
>MEL_SACPS (Q03647) Alpha-galactosidase precursor (EC 3.2.1.22) (Melibiase)| (Alpha-D-galactoside galactohydrolase) (MELx) Length = 471 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 3 CWRSGHEPGGVLQALQGYYRKRKTPLSDSTVAQHLHRRSVL 125 CW SG G L A K K P S VA HLH + L Sbjct: 74 CWSSGRTANGTLVA-----DKEKFPNGMSHVADHLHNNNFL 109
>MEL6_YEAST (P41947) Alpha-galactosidase 6 precursor (EC 3.2.1.22) (Melibiase| 6) (Alpha-D-galactoside galactohydrolase 6) Length = 471 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 3 CWRSGHEPGGVLQALQGYYRKRKTPLSDSTVAQHLHRRSVL 125 CW SG + G L A K K P VA HLH S L Sbjct: 74 CWSSGRDSDGFLVA-----DKHKFPNGMGHVADHLHNNSFL 109
>MEL5_YEAST (P41946) Alpha-galactosidase 5 precursor (EC 3.2.1.22) (Melibiase| 5) (Alpha-D-galactoside galactohydrolase 5) Length = 471 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 3 CWRSGHEPGGVLQALQGYYRKRKTPLSDSTVAQHLHRRSVL 125 CW SG + G L A K K P VA HLH S L Sbjct: 74 CWSSGRDSDGFLVA-----DKHKFPNGMGHVADHLHNNSFL 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,369,973 Number of Sequences: 219361 Number of extensions: 630635 Number of successful extensions: 1634 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1634 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)