| Clone Name | rbaal18k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATX7_MOUSE (Q8R4I1) Ataxin-7 (Spinocerebellar ataxia type 7 prot... | 32 | 1.7 | 2 | DAXX_RAT (Q8VIB2) Death domain-associated protein 6 (Daxx) | 32 | 2.2 | 3 | LTBP2_HUMAN (Q14767) Latent transforming growth factor beta-bind... | 32 | 2.2 | 4 | DAXX_MOUSE (O35613) Death domain-associated protein 6 (Daxx) | 30 | 4.8 | 5 | K1683_HUMAN (Q9H0B3) Protein KIAA1683 | 30 | 4.8 |
|---|
>ATX7_MOUSE (Q8R4I1) Ataxin-7 (Spinocerebellar ataxia type 7 protein homolog)| Length = 867 Score = 32.0 bits (71), Expect = 1.7 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Frame = -3 Query: 640 KIAPGPAVLLHLQLVPSTIVLPTCSLLGFDELSSRAPPTDPPSACSRLPSG--DARLQRW 467 K P L+ Q S + P CS+ L+S +PP+ PS S +PS + Q+W Sbjct: 595 KSVPAHGTTLNAQPAGSGAMDPVCSVQSRQVLASSSPPS-TPSGLSSVPSSPLSRKPQKW 653 Query: 466 EGSRRGRDK 440 + S+ R K Sbjct: 654 KPSKSIRPK 662
>DAXX_RAT (Q8VIB2) Death domain-associated protein 6 (Daxx)| Length = 731 Score = 31.6 bits (70), Expect = 2.2 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -3 Query: 550 ELSSRAPPTDPPSACSRLPSGDARLQRWEGSRRGRDKLPHLTSNY 416 E S PPTDPPS + + + R GSRR +L L + Y Sbjct: 152 ESSGDNPPTDPPSDLTNTETTASEASRTRGSRRQIQRLEQLLALY 196
>LTBP2_HUMAN (Q14767) Latent transforming growth factor beta-binding protein 2| precursor (LTBP-2) Length = 1821 Score = 31.6 bits (70), Expect = 2.2 Identities = 19/52 (36%), Positives = 23/52 (44%) Frame = -3 Query: 643 PKIAPGPAVLLHLQLVPSTIVLPTCSLLGFDELSSRAPPTDPPSACSRLPSG 488 P G A + Q+ PST VL T S G D ++ A P C LP G Sbjct: 816 PMPEQGIAEIQEEQVTPSTDVLVTLSTPGIDRCAAGATNVCGPGTCVNLPDG 867
>DAXX_MOUSE (O35613) Death domain-associated protein 6 (Daxx)| Length = 739 Score = 30.4 bits (67), Expect = 4.8 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -3 Query: 550 ELSSRAPPTDPPSACSRLPSGDARLQRWEGSRRGRDKLPHLTSNY 416 E S PPT+PPS + + + R GSRR +L L + Y Sbjct: 160 EASGPNPPTEPPSDLTNTENTASEASRTRGSRRQIQRLEQLLALY 204
>K1683_HUMAN (Q9H0B3) Protein KIAA1683| Length = 1180 Score = 30.4 bits (67), Expect = 4.8 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 7/60 (11%) Frame = -3 Query: 649 SLPKIAPGPAVL-----LHLQLVPSTIVLPTCSLLGFDELSSRAPP--TDPPSACSRLPS 491 SLP++ PGPA+ +H P+ L TC + SS+ P PS +RLP+ Sbjct: 440 SLPQVCPGPAMAKTPPQMHPVTTPAKNPLQTCLSATMSKTSSQRSPVGVTKPSPQTRLPA 499 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,395,026 Number of Sequences: 219361 Number of extensions: 1804002 Number of successful extensions: 4588 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4584 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)