| Clone Name | rbaal18h15 |
|---|---|
| Clone Library Name | barley_pub |
>AGO1_SCHPO (O74957) Cell cycle control protein ago1 (RNA interference pathway| protein ago1) Length = 834 Score = 31.2 bits (69), Expect = 1.4 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -1 Query: 332 GGGSKAWRGVYQPNDDKLQFFYDGQGFMSLQLNKDQADFIFYDVSGKVLYEWT 174 GGG +AW+G YQ QGFMS+ ++ + F D ++L E+T Sbjct: 174 GGGVEAWKGFYQS-------IRPNQGFMSVNVDISSSAFWRNDSLLQILMEYT 219
>RPOC_PSEF5 (Q4K527) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1399 Score = 30.0 bits (66), Expect = 3.2 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +3 Query: 324 TASTSEVLDWTVSAANVFQAVVMPIDVEVDAVNLEDRKKQLQELL 458 + S + ++D TV A +FQ V+P + D VNL +KK + +L+ Sbjct: 563 SVSATRIVDTTVGRALLFQ--VVPKGLSFDVVNLPMKKKAISKLI 605
>GTFD_STRMU (P49331) Glucosyltransferase-S precursor (EC 2.4.1.5) (GTF-S)| (Dextransucrase) (Sucrose 6-glucosyltransferase) Length = 1462 Score = 29.3 bits (64), Expect = 5.5 Identities = 18/92 (19%), Positives = 35/92 (38%), Gaps = 21/92 (22%) Frame = -1 Query: 407 FYINGHDHCLEHISSRNSPIQYFTSGG---------------------GSKAWRGVYQPN 291 +Y + + H + + N +QYF S G G++ G Y + Sbjct: 1128 YYFDNNGHMVYGLQHLNGEVQYFLSNGVQLRESFLENADGSKNYFGHLGNRYSNGYYSFD 1187 Query: 290 DDKLQFFYDGQGFMSLQLNKDQADFIFYDVSG 195 +D ++D G M++ L + ++D G Sbjct: 1188 NDSKWRYFDASGVMAVGLKTINGNTQYFDQDG 1219
>RPOC_PSEPF (Q3K5Y2) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1399 Score = 28.9 bits (63), Expect = 7.2 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 324 TASTSEVLDWTVSAANVFQAVVMPIDVEVDAVNLEDRKKQLQELL 458 + + + ++D TV A +FQ V+P + D VNL +KK + +L+ Sbjct: 563 SVNNTRIVDTTVGRALLFQ--VVPKGLSFDVVNLPMKKKAISKLI 605
>ATP8_MYXGL (O63913) ATP synthase protein 8 (EC 3.6.3.14) (ATPase subunit 8)| (A6L) Length = 54 Score = 28.5 bits (62), Expect = 9.4 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Frame = +1 Query: 364 LLMCSRQWSC-PLM*KSM----PLTLRTGRSNCRSSSVSPW 471 LLM W C PLM S+ PLTL+T + SS +PW Sbjct: 10 LLMALSLWVCFPLMMLSLSSFLPLTLKTSLPSTLKSSPNPW 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,397,904 Number of Sequences: 219361 Number of extensions: 1459392 Number of successful extensions: 3213 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3209 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)