| Clone Name | rbaal18g14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Exci... | 30 | 6.6 | 2 | DRI_DROME (Q24573) Protein dead ringer (Protein retained) | 30 | 6.6 | 3 | GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing... | 29 | 8.6 | 4 | TRMU_LACAC (Q5FKU0) Probable tRNA (5-methylaminomethyl-2-thiouri... | 29 | 8.6 |
|---|
>UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 939 Score = 29.6 bits (65), Expect = 6.6 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -1 Query: 341 DVMILVSIVQPLLEEINAILV-KHQLDMLKC 252 DV LV I+Q L++ N ++V +H LDM+KC Sbjct: 866 DVNRLVKILQRLVDGGNTVIVIEHNLDMIKC 896
>DRI_DROME (Q24573) Protein dead ringer (Protein retained)| Length = 911 Score = 29.6 bits (65), Expect = 6.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 29 YDTSNPLQLQGHKHIQQRHL*QLNKKGVWNQP 124 +D S P Q+ GH H Q HL + + + N P Sbjct: 695 HDDSEPQQMNGHHHHQTHHLDKSDDSAIENSP 726
>GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing protein 1| (Lengsin) (Lens glutamine synthase-like) Length = 563 Score = 29.3 bits (64), Expect = 8.6 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = +3 Query: 18 QISSMIHPTHYNYKGTNTYSKDISDSLTKRESGTNHQQFLKETPTNLHFTMQARLI 185 + S PT YN + N K+E NH QF++ T+LH +++ I Sbjct: 103 EFSPNTDPTRYNAQSFNPPQLSARMKHIKQEMAKNHLQFVRFEATDLHGVSRSKSI 158
>TRMU_LACAC (Q5FKU0) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 375 Score = 29.3 bits (64), Expect = 8.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 336 HDIGLHCTASARGDQCHFG*TPAGHA 259 HD +HCTA R QC G T HA Sbjct: 301 HDFEMHCTAKFRYRQCDIGVTVKYHA 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,735,289 Number of Sequences: 219361 Number of extensions: 1553111 Number of successful extensions: 3161 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3161 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)