| Clone Name | rbaal18e24 |
|---|---|
| Clone Library Name | barley_pub |
>RAD23_ORYSA (Q40742) Putative DNA repair protein RAD23 (OsRAD23)| Length = 392 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLLDXMNEXXXGAP 172 MGFDRALV+ V+FACNKDE LAANYLLD MNE P Sbjct: 354 MGFDRALVLDVFFACNKDEQLAANYLLDHMNEFDDEGP 391
>RD23D_ARATH (Q84L30) Putative DNA repair protein RAD23-4 (RAD23-like protein 4)| (AtRAD23-4) Length = 378 Score = 57.4 bits (137), Expect = 9e-09 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 288 GMGFDRALVVKVYFACNKDETLAANYLLDXMNE 190 GMGFDRA+V++V+FACNK+E LAANYLLD M+E Sbjct: 342 GMGFDRAMVLEVFFACNKNEELAANYLLDHMHE 374
>RD23C_ARATH (Q84L31) Putative DNA repair protein RAD23-3 (RAD23-like protein 3)| (AtRAD23-3) Length = 419 Score = 54.3 bits (129), Expect = 8e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLLDXMNE 190 MGF+RALV++V+FACNK+E LAANYLLD M+E Sbjct: 385 MGFERALVLEVFFACNKNEELAANYLLDHMHE 416
>RD23A_ARATH (Q84L33) Putative DNA repair protein RAD23-1 (RAD23-like protein 1)| (AtRAD23-1) Length = 371 Score = 44.3 bits (103), Expect = 8e-05 Identities = 18/28 (64%), Positives = 25/28 (89%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLLD 202 MGFDRALV++ + AC+++E LAANYLL+ Sbjct: 337 MGFDRALVIEAFLACDRNEELAANYLLE 364
>RD23B_ARATH (Q84L32) Putative DNA repair protein RAD23-2 (RAD23-like protein 2)| (AtRAD23-2) Length = 368 Score = 42.4 bits (98), Expect = 3e-04 Identities = 16/28 (57%), Positives = 25/28 (89%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLLD 202 MGFDRA+V++ + +C+++E LAANYLL+ Sbjct: 334 MGFDRAIVIEAFLSCDRNEELAANYLLE 361
>RHP23_SCHPO (O74803) UV excision repair protein rhp23 (RAD23 homolog)| Length = 368 Score = 42.0 bits (97), Expect = 4e-04 Identities = 17/32 (53%), Positives = 25/32 (78%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLLDXMNE 190 +GFDR +V++ Y AC+K+E LAANYL + +E Sbjct: 332 LGFDRNIVIQAYLACDKNEELAANYLFEHGHE 363
>RD23A_MOUSE (P54726) UV excision repair protein RAD23 homolog A (mHR23A)| Length = 363 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLL 205 +GF +LV++ YFAC K+E LAAN+LL Sbjct: 330 LGFPESLVIQAYFACEKNENLAANFLL 356
>RD23A_HUMAN (P54725) UV excision repair protein RAD23 homolog A (hHR23A)| Length = 363 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/27 (59%), Positives = 22/27 (81%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLL 205 +GF +LV++ YFAC K+E LAAN+LL Sbjct: 330 LGFPESLVIQAYFACEKNENLAANFLL 356
>RD23B_HUMAN (P54727) UV excision repair protein RAD23 homolog B (hHR23B) (XP-C| repair-complementing complex 58 kDa protein) (p58) Length = 409 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLL 205 +GF LV++ YFAC K+E LAAN+LL Sbjct: 376 LGFPEGLVIQAYFACEKNENLAANFLL 402
>RD23B_MOUSE (P54728) UV excision repair protein RAD23 homolog B (mHR23B) (XP-C| repair-complementing complex 58 kDa protein) (p58) Length = 416 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYLL 205 +GF LV++ YFAC K+E LAAN+LL Sbjct: 383 LGFPEGLVIQAYFACEKNENLAANFLL 409
>RAD23_YEAST (P32628) UV excision repair protein RAD23| Length = 398 Score = 38.5 bits (88), Expect = 0.004 Identities = 16/26 (61%), Positives = 22/26 (84%) Frame = -3 Query: 285 MGFDRALVVKVYFACNKDETLAANYL 208 +GF+R LV++VYFAC+K+E AAN L Sbjct: 367 LGFERDLVIQVYFACDKNEEAAANIL 392
>MMAC_MOUSE (Q9CZD0) Methylmalonic aciduria and homocystinuria type C homolog| Length = 279 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 Query: 105 IDTPALXGQALEIFLRXCHF 46 + TPA+ +AL+ FL+ CHF Sbjct: 53 LSTPAMFDRALKPFLKSCHF 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,821,022 Number of Sequences: 219361 Number of extensions: 435789 Number of successful extensions: 921 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)