| Clone Name | rbaal17o16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | N2B_HAEIR (P46441) Putative ATPase N2B (HFN2B) | 56 | 1e-10 | 2 | AFG1_YEAST (P32317) Protein AFG1 | 50 | 6e-06 | 3 | YHCM_ECOLI (P64612) Hypothetical protein yhcM | 40 | 2e-04 | 4 | YHCM_ECO57 (P64613) Hypothetical protein yhcM | 40 | 2e-04 |
|---|
>N2B_HAEIR (P46441) Putative ATPase N2B (HFN2B)| Length = 464 Score = 56.2 bits (134), Expect(2) = 1e-10 Identities = 23/67 (34%), Positives = 44/67 (65%) Frame = -2 Query: 582 DLCDKPIGAADYFGLFKKFHTLAVEGVPKFGYHNRTAAYRFVTLVDVMYENKGRLLCTAE 403 +LC++P+G +DY + + FHT+ + VP+ ++ RF+TL+D +Y+N+ R++ +AE Sbjct: 334 ELCNRPLGGSDYIQIGQFFHTVLIHDVPQLTLLLKSQMRRFITLIDTLYDNRVRVVISAE 393 Query: 402 AEPIELF 382 +LF Sbjct: 394 VPLDQLF 400 Score = 28.9 bits (63), Expect(2) = 1e-10 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -3 Query: 278 FAKDRTISRLTELNSREYLEDF 213 FA DRTISRL E+ +EY E + Sbjct: 439 FAFDRTISRLYEMQKKEYWEQW 460
>AFG1_YEAST (P32317) Protein AFG1| Length = 509 Score = 49.7 bits (117), Expect = 6e-06 Identities = 23/66 (34%), Positives = 34/66 (51%) Frame = -2 Query: 579 LCDKPIGAADYFGLFKKFHTLAVEGVPKFGYHNRTAAYRFVTLVDVMYENKGRLLCTAEA 400 LC +P+ A DY L K F V +P + R RF+T +D +Y++ G+L T A Sbjct: 367 LCGEPLAAGDYLTLAKNFEAFIVTDIPYLSIYVRDEVRRFITFLDAVYDSGGKLATTGAA 426 Query: 399 EPIELF 382 + LF Sbjct: 427 DFSSLF 432
>YHCM_ECOLI (P64612) Hypothetical protein yhcM| Length = 375 Score = 40.0 bits (92), Expect(2) = 2e-04 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = -2 Query: 579 LCDKPIGAADYFGLFKKFHTLAVEGVPKFGYHNRTAAYRFVTLVDVMYENKGRLLCTAEA 400 LC DY L + FHT+ + VP + A RF+ LVD YE +L+ +AE Sbjct: 278 LCVDARSQHDYIALSRLFHTVMLFDVPVMTRLMESEARRFIALVDEFYERHVKLVVSAEV 337 Query: 399 EPIELFE 379 E+++ Sbjct: 338 PLYEIYQ 344 Score = 24.3 bits (51), Expect(2) = 2e-04 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 290 NELGFAKDRTISRLTELNSREYLE 219 + L F R +SRL E+ S EYL+ Sbjct: 346 DRLKFEFQRCLSRLQEMQSEEYLK 369
>YHCM_ECO57 (P64613) Hypothetical protein yhcM| Length = 375 Score = 40.0 bits (92), Expect(2) = 2e-04 Identities = 22/67 (32%), Positives = 33/67 (49%) Frame = -2 Query: 579 LCDKPIGAADYFGLFKKFHTLAVEGVPKFGYHNRTAAYRFVTLVDVMYENKGRLLCTAEA 400 LC DY L + FHT+ + VP + A RF+ LVD YE +L+ +AE Sbjct: 278 LCVDARSQHDYIALSRLFHTVMLFDVPVMTRLMESEARRFIALVDEFYERHVKLVVSAEV 337 Query: 399 EPIELFE 379 E+++ Sbjct: 338 PLYEIYQ 344 Score = 24.3 bits (51), Expect(2) = 2e-04 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 290 NELGFAKDRTISRLTELNSREYLE 219 + L F R +SRL E+ S EYL+ Sbjct: 346 DRLKFEFQRCLSRLQEMQSEEYLK 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,702,316 Number of Sequences: 219361 Number of extensions: 1471564 Number of successful extensions: 2988 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2988 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)