| Clone Name | rbaal17n14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IF2B_SULAC (Q4JA57) Translation initiation factor 2 beta subunit... | 30 | 2.0 | 2 | DMN_HUMAN (O15061) Desmuslin | 30 | 2.0 | 3 | T5377_BACST (Q45620) Probable transposase for insertion sequence... | 29 | 2.6 | 4 | ZHX1_MOUSE (P70121) Zinc fingers and homeoboxes protein 1 | 23 | 5.6 | 5 | SYF1_USTMA (Q4P7S1) Pre-mRNA-splicing factor SYF1 | 28 | 5.9 | 6 | KPK1_ARATH (P42818) Serine/threonine-protein kinase AtPK1/AtPK6 ... | 28 | 5.9 |
|---|
>IF2B_SULAC (Q4JA57) Translation initiation factor 2 beta subunit (eIF-2-beta)| (aIF2-beta) Length = 141 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 160 KRRPLGQSRSARPVVLKQGETTLARSLFSFCPAPRKQRSTCM 285 K + GQ +VL+ G TT+ R+ +C R++ CM Sbjct: 23 KAQKSGQQNLPNLIVLQVGNTTIIRNFSEYCDRIRREDKLCM 64
>DMN_HUMAN (O15061) Desmuslin| Length = 1565 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +1 Query: 154 SSKRRPLGQSRSARPVVLKQGETTLARSLFSFCPAP 261 S P G SRS R V L G++ L+R + PAP Sbjct: 1159 SQAASPTGASRSVRHVTLGPGQSPLSREVIFLGPAP 1194
>T5377_BACST (Q45620) Probable transposase for insertion sequence element IS5377| Length = 377 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 242 KRLLAKVVSPCFKTTGRALRL*PNGLRLLES 150 KRLLA ++S C + T R+LR P LR+++S Sbjct: 89 KRLLALIISKCNRQTRRSLRF-PKPLRVVDS 118
>ZHX1_MOUSE (P70121) Zinc fingers and homeoboxes protein 1| Length = 873 Score = 23.5 bits (49), Expect(2) = 5.6 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 227 KVVSPCFKTTGRALRL*PNGLRLLESE*LRTKW 129 + V+P TG+ + P L +L+S +RT+W Sbjct: 652 ETVAPKSGGTGKICKKTPEQLHMLKSAFVRTQW 684 Score = 23.1 bits (48), Expect(2) = 5.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 Query: 121 VRNAWESAEQFGPNPEESSKALFD 50 VR W SAE++ EES A D Sbjct: 680 VRTQWPSAEEYDKLAEESGLARTD 703
>SYF1_USTMA (Q4P7S1) Pre-mRNA-splicing factor SYF1| Length = 1081 Score = 28.1 bits (61), Expect = 5.9 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = +1 Query: 25 PLPNTTQAHQTALLSFLQDLARTVRQIPTRYAPVRHFVLNYSDSSKRRPLGQSRSAR 195 PL ++TQ +TAL R + Q PTRY+ R ++ N S P G S + R Sbjct: 109 PLASSTQ--RTALRRLTSIYERALAQFPTRYSLWRDYLQNRSRFVLGDPKGGSDAKR 163
>KPK1_ARATH (P42818) Serine/threonine-protein kinase AtPK1/AtPK6 (EC 2.7.11.1)| Length = 465 Score = 28.1 bits (61), Expect = 5.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 106 ESAEQFGPNPEESSKALFDEPA 41 E ++ FGP PEE++ +DEPA Sbjct: 34 EFSDVFGPLPEEANDIAYDEPA 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,151,948 Number of Sequences: 219361 Number of extensions: 632346 Number of successful extensions: 1699 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1699 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)