| Clone Name | rbaal18a23 |
|---|---|
| Clone Library Name | barley_pub |
>LAS17_YEAST (Q12446) Proline-rich protein LAS17| Length = 633 Score = 32.7 bits (73), Expect = 0.24 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +3 Query: 153 RRCRQAHTPRRDGRFENY---YSVRGRDTIHVRAHQQPPPPPHDRSTMNS 293 ++ + H PR + +N Y+ DTI H+ PPPPP T +S Sbjct: 148 QKSQVVHGPRGESLIDNQRKRYNYEDVDTIPTTKHKAPPPPPPTAETFDS 197
>NONO_PONPY (Q5RFL9) Non-POU domain-containing octamer-binding protein (NonO| protein) Length = 471 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 162 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 269 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NONO_HUMAN (Q15233) Non-POU domain-containing octamer-binding protein (NonO| protein) (54 kDa nuclear RNA- and DNA-binding protein) (p54(nrb)) (p54nrb) (55 kDa nuclear protein) (NMT55) (DNA-binding p52/p100 complex, 52 kDa subunit) Length = 471 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 162 RQAHTPRRDGRFENYYSVRGRDTIHVRAHQQPPPPP 269 +Q HTPR+ ++ + H + QQPPPPP Sbjct: 11 KQNHTPRK------HHQHHHQQQHHQQQQQQPPPPP 40
>NO75_LUPLU (Q06841) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 434 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 3/23 (13%) Frame = +3 Query: 231 IHVRAHQQPP---PPPHDRSTMN 290 +H +H++PP PPPH++S M+ Sbjct: 267 VHPPSHEKPPFVYPPPHEKSPMH 289
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 153 RRCRQAHTPRRDGRFENYYSVRGRDTI 233 RR + + PR +ENYYS G D + Sbjct: 346 RRALRCYKPRLKATYENYYSSNGLDAV 372
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.7 bits (60), Expect = 7.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 Query: 246 HQQPPPPPHDRSTM 287 HQ PPPPPH S++ Sbjct: 109 HQPPPPPPHSLSSL 122
>CYTSA_TETNG (Q2KN95) Cytospin-A| Length = 1113 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 148 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 53 F SAS S+ + PT P+PRTP +P+ Sbjct: 832 FDSASQGPPSSGASVTPTASAAPLPRTPLSPS 863
>CYTSA_FUGRU (Q2KN94) Cytospin-A| Length = 1118 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 Query: 148 FKSASFSQYSTCCTTFPTFCIVPVPRTPFNPA 53 F SAS S + PT P+PRTP +P+ Sbjct: 837 FDSASQGPPSNGASVTPTVSAAPLPRTPLSPS 868 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,652,013 Number of Sequences: 219361 Number of extensions: 743928 Number of successful extensions: 4098 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3655 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)