| Clone Name | rbaal17l21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | K0196_MOUSE (Q8C2E7) Protein KIAA0196 | 32 | 1.3 | 2 | K0196_HUMAN (Q12768) Protein KIAA0196 | 31 | 2.9 |
|---|
>K0196_MOUSE (Q8C2E7) Protein KIAA0196| Length = 1159 Score = 32.0 bits (71), Expect = 1.3 Identities = 22/64 (34%), Positives = 33/64 (51%) Frame = -1 Query: 241 TRSFMRGLIRTAVINIHMEIVRTVDISVLQTYEDHHAIAIWLVADKLTSIQTESINIRRS 62 TR F+ +IRT INI E++ TV I ++ W + D TSI ESI + S Sbjct: 527 TRKFLHQMIRT--INIKEEVLITVQIIGDLSFA-------WQLIDSFTSIMQESIRVNPS 577 Query: 61 VLVQ 50 ++ + Sbjct: 578 MVTK 581
>K0196_HUMAN (Q12768) Protein KIAA0196| Length = 1159 Score = 30.8 bits (68), Expect = 2.9 Identities = 21/64 (32%), Positives = 33/64 (51%) Frame = -1 Query: 241 TRSFMRGLIRTAVINIHMEIVRTVDISVLQTYEDHHAIAIWLVADKLTSIQTESINIRRS 62 TR F+ +IRT INI E++ T+ I ++ W + D TSI ESI + S Sbjct: 527 TRKFLHQMIRT--INIKEEVLITMQIVGDLSFA-------WQLIDSFTSIMQESIRVNPS 577 Query: 61 VLVQ 50 ++ + Sbjct: 578 MVTK 581 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,664,522 Number of Sequences: 219361 Number of extensions: 1476804 Number of successful extensions: 3507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3507 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)