| Clone Name | rbaal17k22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUIS_SUNMU (O62653) Sucrase-isomaltase, intestinal [Contains: Su... | 32 | 1.3 | 2 | C26AA_BACTF (Q9X597) Pesticidal crystal protein cry26Aa (Insecti... | 29 | 8.6 | 3 | TECT2_RAT (Q3B7D3) Tectonic-2 precursor | 29 | 8.6 |
|---|
>SUIS_SUNMU (O62653) Sucrase-isomaltase, intestinal [Contains: Sucrase (EC| 3.2.1.48); Isomaltase (EC 3.2.1.10)] Length = 1812 Score = 32.0 bits (71), Expect = 1.3 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 375 RYRSIG*IFWETCIDWSICMSDQLTQKCT 289 R RS G IFW++C+ W + + +Q Q T Sbjct: 1060 RRRSTGRIFWDSCLPWGLLLMNQFIQIST 1088
>C26AA_BACTF (Q9X597) Pesticidal crystal protein cry26Aa (Insecticidal| delta-endotoxin CryXXVIA(a)) (Crystaline entomocidal protoxin) (131 kDa crystal protein) Length = 1163 Score = 29.3 bits (64), Expect = 8.6 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 112 STQTTNIGRIVHFPTFQLEFKGLNSKQTQSKQQG 213 +T+T N G IV+ + +L F+G N +T S QG Sbjct: 380 TTETRNYGTIVNHDSVELNFEGKNIYKTGSLPQG 413
>TECT2_RAT (Q3B7D3) Tectonic-2 precursor| Length = 700 Score = 29.3 bits (64), Expect = 8.6 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 392 HFMFKWMNNWASS-ESTLVSA*LAAHERTCLLPARNIK 502 H++F+W NN SS + T++ A + AH+R + +K Sbjct: 382 HYVFRWQNNSISSLDITIIRAEINAHQRGTMTQRFTVK 419 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,494,026 Number of Sequences: 219361 Number of extensions: 1666409 Number of successful extensions: 3289 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3289 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)