| Clone Name | rbaal17i20 |
|---|---|
| Clone Library Name | barley_pub |
>DRI_DROME (Q24573) Protein dead ringer (Protein retained)| Length = 911 Score = 29.6 bits (65), Expect = 4.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 4 YDTSNPLQLQGHKHIQQRHL*QLNKKGVWNQP 99 +D S P Q+ GH H Q HL + + + N P Sbjct: 695 HDDSEPQQMNGHHHHQTHHLDKSDDSAIENSP 726
>UVRA_CLOPE (Q8XNI5) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 939 Score = 29.6 bits (65), Expect = 4.1 Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -3 Query: 316 DVMILVSIVQPLLEEINAILV-KHQLDMLKC 227 DV LV I+Q L++ N ++V +H LDM+KC Sbjct: 866 DVNRLVKILQRLVDGGNTVIVIEHNLDMIKC 896
>TRMU_LACAC (Q5FKU0) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 375 Score = 29.3 bits (64), Expect = 5.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 311 HDIGLHCTASARGDQCHFG*TPAGHA 234 HD +HCTA R QC G T HA Sbjct: 301 HDFEMHCTAKFRYRQCDIGVTVKYHA 326
>GLUD1_MOUSE (Q8CIX8) Glutamate--ammonia ligase domain-containing protein 1| (Lengsin) (Lens glutamine synthase-like) Length = 563 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = +2 Query: 14 PTHYNYKGTNTYSKDISDSLTKRESGTNHQQFLKETPTNLHFTMQARLI 160 PT YN + N K+E NH QF++ T+LH +++ I Sbjct: 110 PTRYNAQSFNPPQLSARMKHIKQEMAKNHLQFVRFEATDLHGVSRSKSI 158
>VGLH_MEHV1 (P36337) Glycoprotein H precursor| Length = 808 Score = 28.5 bits (62), Expect = 9.2 Identities = 24/106 (22%), Positives = 43/106 (40%), Gaps = 5/106 (4%) Frame = +2 Query: 89 GTNHQQFLKETPTNLHFTMQARLIS-----LCSTVVDMYNHQVIGHPCVSGAFEHVQLVF 253 G + F K+ T HF + I L +++ + GH A +H+ L+ Sbjct: 363 GISSAAFRKDAST--HFLISGTPIKDSKADLIKSLLSKVIRPISGHTRPLSAIQHLFLLR 420 Query: 254 NQNGIDLL*QRLYNGDQYHDISSKILRILAAPHQQLNKDLSFWNET 391 + +D+ Q NG +S+ L + H + +D+ WN T Sbjct: 421 SAYALDIPRQ---NGSLSEQVSTVALSFIENIHSEAMRDILSWNTT 463
>UVRA_SYNY3 (P73412) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 970 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/32 (37%), Positives = 26/32 (81%), Gaps = 1/32 (3%) Frame = -3 Query: 316 DVMILVSIVQPLLEEINAILV-KHQLDMLKCT 224 DV L++++Q L+++ N++LV +H LD+++C+ Sbjct: 895 DVHHLLNVLQRLVDKGNSVLVIEHNLDVIRCS 926
>UVRA_CLOAB (Q97LQ1) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 939 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Frame = -3 Query: 316 DVMILVSIVQPLLEEINAILV-KHQLDMLKC 227 DV L+SI+Q L + N ++V +H LD++KC Sbjct: 866 DVKKLISILQRLTDMGNTVVVIEHNLDVIKC 896
>UVRA_AQUAE (O66911) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 926 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/31 (38%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = -3 Query: 316 DVMILVSIVQPLLEEINAILV-KHQLDMLKC 227 DV L+ ++Q L+++ N ++V +H LD++KC Sbjct: 846 DVKKLIDVLQRLVDKGNTVVVIEHNLDVIKC 876
>KCNB1_RAT (P15387) Potassium voltage-gated channel subfamily B member 1| (Voltage-gated potassium channel subunit Kv2.1) (DRK1) Length = 857 Score = 28.5 bits (62), Expect = 9.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 228 HLSMSSWCLTKMALISSSRGCTMETNIMTSPPKSSGS 338 HLS + W TK AL +S + ET SP K+ S Sbjct: 482 HLSPNKWKWTKRALSETSSSKSFETKEQGSPEKARSS 518
>KCNB1_MOUSE (Q03717) Potassium voltage-gated channel subfamily B member 1| (Voltage-gated potassium channel subunit Kv2.1) (mShab) Length = 857 Score = 28.5 bits (62), Expect = 9.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 228 HLSMSSWCLTKMALISSSRGCTMETNIMTSPPKSSGS 338 HLS + W TK AL +S + ET SP K+ S Sbjct: 482 HLSPNKWKWTKRALSETSSSKSFETKEQGSPEKARSS 518
>MOBC_BPT4 (P07074) Probable mobile endonuclease C| Length = 210 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 47 YSKDISDSLTKRESGTNHQQFLKETPTN 130 + K ISD LT R TNH++ +K + N Sbjct: 126 FGKRISDGLTGRTLSTNHKEHIKNSSRN 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,408,639 Number of Sequences: 219361 Number of extensions: 1329684 Number of successful extensions: 2842 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2842 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)