| Clone Name | rbaal17g15 |
|---|---|
| Clone Library Name | barley_pub |
>VEGFA_BOVIN (P15691) Vascular endothelial growth factor A precursor (VEGF-A)| (Vascular permeability factor) (VPF) Length = 190 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 607 CGMCCTDADM--IYQEQYH*AYFS*TVFPHNLQKSGEISILQVKSCD 473 CG CC D + + E+++ + PH Q GE+S LQ C+ Sbjct: 82 CGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCE 128
>VEGFA_SHEEP (P50412) Vascular endothelial growth factor A precursor (VEGF-A)| (Vascular permeability factor) (VPF) Length = 146 Score = 30.4 bits (67), Expect = 4.2 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 607 CGMCCTDADM--IYQEQYH*AYFS*TVFPHNLQKSGEISILQVKSCD 473 CG CC D + + E+++ + PH Q GE+S LQ C+ Sbjct: 82 CGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCE 128
>VEGFA_CAVPO (P26617) Vascular endothelial growth factor A (VEGF-A) (Vascular| permeability factor) (VPF) Length = 164 Score = 29.6 bits (65), Expect = 7.1 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 607 CGMCCTDADM--IYQEQYH*AYFS*TVFPHNLQKSGEISILQVKSCD 473 CG CC D + + E+++ + PH Q GE+S LQ C+ Sbjct: 56 CGGCCNDESLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCE 102
>HIRA_DROME (O17468) HIRA protein homolog (dHIRA)| Length = 1047 Score = 29.3 bits (64), Expect = 9.3 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 95 GVGREAPVREETARTVTSRGDFPLIYVISFNTPPNLR 205 G+G+ APV E R + +GD P + +S N N R Sbjct: 383 GLGKSAPVLEHPQRLLLPQGDKPTKFPLSNNNEANQR 419
>MSTAA_DROME (O46040) Protein msta, isoform A| Length = 462 Score = 29.3 bits (64), Expect = 9.3 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 7/78 (8%) Frame = +2 Query: 107 EAPVREETARTVTSRGDFPLIYVISFNTPPNL-------RLTMWSRLHDCPGSFIIKNSS 265 EAP R T+ RG FPL +++ PN RL + D P I + Sbjct: 228 EAPCRSGGHETLL-RGLFPLTAIMNHECTPNASHYFENGRLAVVRAARDIPKGGEITTTY 286 Query: 266 SKVLHKDFDENLKCKLTK 319 +K+L + N+ K+TK Sbjct: 287 TKILWGNLTRNIFLKMTK 304
>VEGFA_PIG (P49151) Vascular endothelial growth factor A precursor (VEGF-A)| (Vascular permeability factor) (VPF) Length = 190 Score = 29.3 bits (64), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 607 CGMCCTDADM--IYQEQYH*AYFS*TVFPHNLQKSGEISILQVKSCD 473 CG CC D + + E+++ + PH Q GE+S LQ C+ Sbjct: 82 CGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCE 128
>VEGFA_CANFA (Q9MYV3) Vascular endothelial growth factor A precursor (VEGF-A)| (Vascular permeability factor) (VPF) Length = 214 Score = 29.3 bits (64), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 607 CGMCCTDADM--IYQEQYH*AYFS*TVFPHNLQKSGEISILQVKSCD 473 CG CC D + + E+++ + PH Q GE+S LQ C+ Sbjct: 82 CGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCE 128
>LIPA_NITEU (Q82UJ5) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 314 Score = 29.3 bits (64), Expect = 9.3 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -1 Query: 145 CNRSSGF--LPHGRL-SPDSLEPTHLLSVVASLQELYILPVTIDNHXIR 8 C R F + HGR +PD EP HL + +A L+ Y++ ++D +R Sbjct: 87 CTRRCPFCDVAHGRPHAPDPDEPMHLANSIAVLKLNYVVITSVDRDDLR 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,234,630 Number of Sequences: 219361 Number of extensions: 1591638 Number of successful extensions: 3673 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3672 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)