| Clone Name | rbaal17d17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLR12_ARATH (Q9LV72) Glutamate receptor 1.2 precursor (Ligand-ga... | 31 | 2.3 | 2 | MYST4_MOUSE (Q8BRB7) Histone acetyltransferase MYST4 (EC 2.3.1.4... | 29 | 8.8 |
|---|
>GLR12_ARATH (Q9LV72) Glutamate receptor 1.2 precursor (Ligand-gated ion channel| 1.2) Length = 867 Score = 31.2 bits (69), Expect = 2.3 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -3 Query: 254 DVTGIQQFVMSFE---VGVVLEDDDQWQAPAHCFLDDAANEDDDHI 126 +V GI F+ F+ V +VLED D W+ H F+ D +E++ H+ Sbjct: 158 EVKGITAFLHGFDWNSVALVLEDHDDWRESMH-FMVDHFHENNVHV 202
>MYST4_MOUSE (Q8BRB7) Histone acetyltransferase MYST4 (EC 2.3.1.48) (EC 2.3.1.-)| (MYST protein 4) (MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4) (Querkopf protein) Length = 1872 Score = 29.3 bits (64), Expect = 8.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 200 EDDDQWQAPAHCFLDDAANEDDDHIAVSN 114 ED+D+ + P+H DA +EDD H+ +N Sbjct: 1210 EDEDEEEEPSHNEDHDADDEDDGHMEAAN 1238 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,732,404 Number of Sequences: 219361 Number of extensions: 1067824 Number of successful extensions: 2927 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2927 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)