| Clone Name | rbaal16i11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VP5_RDVF (Q85437) Minor core protein P5 | 28 | 4.7 | 2 | VP5_RDVA (P14583) Minor core protein P5 | 28 | 4.7 | 3 | TRA6_BACST (Q45618) Putative transposase for insertion sequence ... | 28 | 8.0 |
|---|
>VP5_RDVF (Q85437) Minor core protein P5| Length = 801 Score = 28.5 bits (62), Expect = 4.7 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 12 APVHTGSKCPPDYTFTKVGSV**QRYVQTICSDELLCTVDDIHAH-YSYVDYRVETRPVL 188 AP++ KC PDY Y T+ S ELL + H Y+ +DY + TR VL Sbjct: 140 APLYNVPKCGPDY------------YGPTVYS-ELLSLATNARTHWYATIDYSMFTRSVL 186
>VP5_RDVA (P14583) Minor core protein P5| Length = 801 Score = 28.5 bits (62), Expect = 4.7 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 12 APVHTGSKCPPDYTFTKVGSV**QRYVQTICSDELLCTVDDIHAH-YSYVDYRVETRPVL 188 AP++ KC PDY Y T+ S ELL + H Y+ +DY + TR VL Sbjct: 140 APLYNVPKCGPDY------------YGPTVYS-ELLSLATNARTHWYATIDYSMFTRSVL 186
>TRA6_BACST (Q45618) Putative transposase for insertion sequence element IS5376| Length = 400 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 132 DIHAHYSYVDYRVETRPVLQVDAFLAGESA 221 ++ A S V V+TRP+ DAFL GES+ Sbjct: 371 EMAATISPVSVEVDTRPLSVYDAFLRGESS 400 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,371,027 Number of Sequences: 219361 Number of extensions: 541739 Number of successful extensions: 1247 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)