| Clone Name | rbaal16h17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLP2_DROME (P32031) Fork head domain transcription factor slp2 (... | 29 | 3.4 | 2 | PSD2_YEAST (P53037) Phosphatidylserine decarboxylase proenzyme 2... | 28 | 4.4 | 3 | AP2B_SCHPO (O43005) AP-2 complex subunit beta (Beta-adaptin) (Cl... | 28 | 5.7 | 4 | YSM1_CAEEL (Q10122) Hypothetical WD-repeat protein F52C9.1 | 27 | 9.8 |
|---|
>SLP2_DROME (P32031) Fork head domain transcription factor slp2 (Sloppy paired| locus protein 2) Length = 445 Score = 28.9 bits (63), Expect = 3.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 225 QRNHGHRPSRRRPAAIETSRHCST 296 +++H HRPS P A+ ++ CST Sbjct: 356 RQDHHHRPSSHHPRAVSSTSDCST 379
>PSD2_YEAST (P53037) Phosphatidylserine decarboxylase proenzyme 2 precursor (EC| 4.1.1.65) [Contains: Phosphatidylserine decarboxylase 2 beta chain; Phosphatidylserine decarboxylase 2 alpha chain] Length = 1138 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 274 SMAAGRLREGRWPWLRWTALRRRWPCPAG*YSCVRTR 164 S+ +L EG W + T +R W CP SC TR Sbjct: 687 SITRSQLVEGLQSWRKSTNFKRIWTCPRCMRSCKPTR 723
>AP2B_SCHPO (O43005) AP-2 complex subunit beta (Beta-adaptin) (Clathrin| assembly protein large beta chain) (Clathrin assembly protein complex 2 beta large chain) Length = 677 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +3 Query: 147 DPNPIFLVLTHEY*PAGQGQRRRNAVQRNHGHRPSRRRPAAIETSRHCSTIWRPT 311 +P+P+ + T + P+ R N + NH H+ S+ R + R+ W P+ Sbjct: 591 EPSPVLRLRTRDSNPSNTDSRESNHKKYNHFHQKSQTRRVMEQYDRNS---WNPS 642
>YSM1_CAEEL (Q10122) Hypothetical WD-repeat protein F52C9.1| Length = 1336 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 Query: 224 PAQPWPSAFSEAAGGHRNLQALQHNMAPDDSSL 322 P PW FSE GG R L ++ + D L Sbjct: 268 PIFPWVCDFSEENGGFRQLNRTKYRLCKGDDQL 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,995,374 Number of Sequences: 219361 Number of extensions: 631045 Number of successful extensions: 1519 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1519 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)