| Clone Name | rbaal16h13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinas... | 28 | 7.2 | 2 | STPA_SYNY3 (Q55034) Glucosylglycerol-phosphate phosphatase (EC 3... | 27 | 9.4 |
|---|
>CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinase 7 (EC| 2.7.11.22) (CDC2-related protein kinase 7) (Cdc2-related kinase, arginine/serine-rich) (CrkRS) Length = 1490 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 347 RRITTRPVLGXRSWSRSTVSGRRSMKFR 264 RR ++ P L RS SRS + R+SMK R Sbjct: 329 RRRSSSPFLSKRSLSRSPLPSRKSMKSR 356
>STPA_SYNY3 (Q55034) Glucosylglycerol-phosphate phosphatase (EC 3.1.3.69)| (Glucosylglycerol 3-phosphatase) (GGP-P) (Salt tolerance protein A) Length = 422 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 3/39 (7%) Frame = -3 Query: 308 WSRSTVSGRRSMKFRFA*G---XXILATMISFYHNRTGK 201 W+++ SG +F G +LA + +YHNRTG+ Sbjct: 234 WAKAGDSGTTDFQFMLRGGVKEAGVLALLNRYYHNRTGQ 272 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,816,812 Number of Sequences: 219361 Number of extensions: 557049 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)