| Clone Name | rbaal16f17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU5M_PICCA (Q37024) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 32 | 1.3 | 2 | Y1184_SYNP6 (P08442) Hypothetical protein syc1184_c | 30 | 4.8 | 3 | U360_SCHJA (Q5DHJ5) UPF0360 protein | 30 | 6.3 | 4 | CHER_LISIN (Q92DX0) Chemotaxis protein methyltransferase (EC 2.1... | 30 | 8.2 |
|---|
>NU5M_PICCA (Q37024) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3)| Length = 644 Score = 32.3 bits (72), Expect = 1.3 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 10/76 (13%) Frame = +2 Query: 398 YGSIDWICLRLNAPMINKLARSFHILCILYIPAFFMSIHH--IWENWSILNTSCQAV--- 562 Y +ID I LNA INK+ F I+ ++Y+ + S+++ I+ S +N + Sbjct: 154 YNNIDNIKSSLNALFINKIGDIFFIIALIYLIYIYKSLNYSLIFSLVSYINIDINNIIIL 213 Query: 563 -----QTISNAQFGFH 595 + +AQFG H Sbjct: 214 CLVIAASAKSAQFGLH 229
>Y1184_SYNP6 (P08442) Hypothetical protein syc1184_c| Length = 417 Score = 30.4 bits (67), Expect = 4.8 Identities = 18/84 (21%), Positives = 40/84 (47%) Frame = -3 Query: 649 QLKKSSFRQLQDAVSQLDVKTKLCIRDGLYRLARSVQNRPVFPNVMNRHEESWDVKDTQN 470 ++ ++ RQ+Q+A++ L + + RDG+ P + R EE W +++ ++ Sbjct: 180 EIGRAEIRQMQEAIALLQGERRGDYRDGVAIGREIFSQLPANNRLRRREEERWALENQRD 239 Query: 469 METSGKFVDHRSIETQTNPIDRSI 398 + +V + I+ T + R I Sbjct: 240 ECFADMYVHPQEIDYNTETLRRWI 263
>U360_SCHJA (Q5DHJ5) UPF0360 protein| Length = 330 Score = 30.0 bits (66), Expect = 6.3 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 407 IDWICLRLNAPMINKLARSFHILCILYIPAFFMSIHHIWENWSIL 541 +D IC L+ P+ N S H+L LY+ F + H +N S++ Sbjct: 287 VDIICALLDIPVYNNRIHSLHLLFSLYLE--FKNSQHFRQNESVI 329
>CHER_LISIN (Q92DX0) Chemotaxis protein methyltransferase (EC 2.1.1.80)| Length = 262 Score = 29.6 bits (65), Expect = 8.2 Identities = 15/59 (25%), Positives = 31/59 (52%) Frame = +3 Query: 153 GTYHTISGKHLHSRRR*LQYINKGDSIKVVLESSQAISNNFHNINQPSFSRGLVVLVMR 329 G Y + + L+ + R +I KGD+ +++ E +AI H++ + +G ++V R Sbjct: 149 GEYQSRQMEELNEQERRSAFIEKGDTYQILPEYRKAIRFRRHDLLTDYYEKGFDLIVCR 207 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,495,408 Number of Sequences: 219361 Number of extensions: 1978757 Number of successful extensions: 4393 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4393 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6200242422 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)