| Clone Name | rbaal16f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region | 27 | 5.7 | 2 | GPC6A_RAT (Q70VB1) G-protein coupled receptor family C group 6 m... | 29 | 6.5 | 3 | LPLA_YERPE (Q8ZDY2) Lipoate-protein ligase A (EC 6.3.2.-) | 29 | 8.5 |
|---|
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 26.6 bits (57), Expect(2) = 5.7 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 51 QSSDLRIMVP-PHSLQHPLLPRSNADSIARQHTQTPLPH 164 Q SD+ I P PH HP P HT TP PH Sbjct: 13 QYSDIYIHTPHPHPHPHPHTPTHT-----HPHTPTPTPH 46 Score = 21.6 bits (44), Expect(2) = 5.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 151 HHCHTSHTVL 180 HH HT HT L Sbjct: 63 HHTHTPHTTL 72
>GPC6A_RAT (Q70VB1) G-protein coupled receptor family C group 6 member A| precursor Length = 928 Score = 29.3 bits (64), Expect = 6.5 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -3 Query: 451 DAFHGDKAHGGVHDGTEVVLWKWCEG 374 ++FH D AHG ++ G EVVLWK G Sbjct: 460 NSFHFD-AHGDLNTGYEVVLWKETNG 484
>LPLA_YERPE (Q8ZDY2) Lipoate-protein ligase A (EC 6.3.2.-)| Length = 338 Score = 28.9 bits (63), Expect = 8.5 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +3 Query: 276 LVPGLIHGDVSMAMQQISWYSIYQGRIFQRWLSPSHHFQSTTSVPSWTPPWA-LSPWK 446 L+PG+ HG + A++Q ++++ Y ++ +SP QS ++P +T +A S W+ Sbjct: 191 LLPGIDHGKIRTAIEQ-AFFAYYDEQVSAEVISP----QSLPNLPGFTEQFAKQSSWE 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,791,173 Number of Sequences: 219361 Number of extensions: 882881 Number of successful extensions: 2989 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2989 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)