| Clone Name | rbaal15p01 |
|---|---|
| Clone Library Name | barley_pub |
>EDN1_RAT (P22388) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 30.4 bits (67), Expect = 3.6 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 270 SVSLRPRRKKMCVCVSICKYVLSEECCLFC 181 S S RPRR K C C S+ + +EC FC Sbjct: 42 STSWRPRRSKRCSCSSL----MDKECVYFC 67
>EDN1_FELCA (Q5NRQ1) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 30.4 bits (67), Expect = 3.6 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -3 Query: 276 ATSVSLRPRRKKMCVCVSICKYVLSEECCLFC 181 A S RPRR K C C S+ L +EC FC Sbjct: 40 APSAPWRPRRSKRCSCSSL----LDKECVYFC 67
>CSN12_ASHGO (Q75BU2) COP9 signalosome complex subunit 12| Length = 412 Score = 30.4 bits (67), Expect = 3.6 Identities = 19/44 (43%), Positives = 23/44 (52%) Frame = +3 Query: 270 RWL*HALLCCIYQVYHLSSGQLIIIILVTVEARARRSQPQRHLL 401 RWL ALL C H QLI+ LV V ARR P+ H++ Sbjct: 227 RWLNTALLTCHRD--HTRHHQLILTYLVPVAFLARRWYPKHHVI 268
>PE2R4_RABIT (Q28691) Prostaglandin E2 receptor, EP4 subtype (Prostanoid EP4| receptor) (PGE receptor, subtype EP4) Length = 488 Score = 30.4 bits (67), Expect = 3.6 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 191 QHSSDS--TYLQIDTHTHIFFRRGLRLTEVALTCFALLYLPSIS 316 QH SDS T + TH+ F R L+ E++ T LLYLP +S Sbjct: 364 QHCSDSRRTSSAMSTHSRSFLSRELK--EISSTSQTLLYLPELS 405
>EDN1_CANFA (P13206) Endothelin-1 precursor (ET-1) (Preproendothelin-1) (PPET1)| Length = 202 Score = 29.6 bits (65), Expect = 6.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -3 Query: 276 ATSVSLRPRRKKMCVCVSICKYVLSEECCLFC 181 A S RPRR K C C S+ + +EC FC Sbjct: 40 APSAPWRPRRSKRCSCSSL----MDKECVYFC 67
>YGHB_SALTY (P0A1F4) Inner membrane protein yghB| Length = 219 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = +1 Query: 493 FAAYFLEVGDLSATFPPGESLLL 561 FA FLE G L A+F PG+SLLL Sbjct: 33 FATLFLENGLLPASFLPGDSLLL 55
>YGHB_SALTI (P0A1F5) Inner membrane protein yghB| Length = 219 Score = 29.6 bits (65), Expect = 6.1 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = +1 Query: 493 FAAYFLEVGDLSATFPPGESLLL 561 FA FLE G L A+F PG+SLLL Sbjct: 33 FATLFLENGLLPASFLPGDSLLL 55
>PYRD_AQUAE (O66461) Dihydroorotate dehydrogenase (EC 1.3.3.1) (Dihydroorotate| oxidase) (DHOdehase) (DHODase) (DHOD) Length = 306 Score = 29.3 bits (64), Expect = 8.0 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = -3 Query: 522 VTDFQKVCCKSAALPFVSIQALRGP*AKKKHW-RLADIVSKSGDAAGVATALLLLR 358 VT+F KVC ++ A V I L G K W R D+ +K+G +G A + +R Sbjct: 172 VTEFAKVCIENGADGLVLINTLMG--MKINIWKRKPDLATKTGGLSGPAILPIAVR 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,883,003 Number of Sequences: 219361 Number of extensions: 1737897 Number of successful extensions: 3878 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3871 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)