| Clone Name | rbaal16d15 |
|---|---|
| Clone Library Name | barley_pub |
>SRP2_SCHPO (P78814) Pre-mRNA-splicing factor srp2| Length = 365 Score = 31.2 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 Query: 240 RRYAGNHRAGIDRRQDGPAFQPGRRQRLRYTQRSQH 133 RRY ++R G D R+D A++PGR RY R ++ Sbjct: 193 RRYRDDYRRGGDYRRD--AYRPGRDDERRYAPRGEY 226
>GAG_BLVAU (P25058) Gag polyprotein [Contains: Core protein p15 (Matrix| protein); Core protein p24; Core protein p12] Length = 391 Score = 30.0 bits (66), Expect = 1.5 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +1 Query: 118 SQSWIM---LASLRVPQTLSSARLKCWTILPPVNACTMVTSITSIKDATAISAXTVVVPR 288 SQ WI LA L+ T + C I PV+ +TS+T+ A A V++P+ Sbjct: 141 SQVWIQTLRLAILQADPTPADLEQLCQYIASPVDQTAHMTSLTAAIAAEAAIPSRVLIPK 200 Query: 289 M 291 M Sbjct: 201 M 201
>PECA1_RAT (Q3SWT0) Platelet endothelial cell adhesion molecule precursor| (PECAM-1) (CD31 antigen) Length = 678 Score = 29.3 bits (64), Expect = 2.5 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +3 Query: 45 HH*LFYKDSXAVCN---KLNTAQVVLLQSIMDHAGFFACT 155 H LFYKD V N +T V+ QS + HAG + CT Sbjct: 61 HQVLFYKDDALVYNVSSSEHTESFVIPQSRVFHAGKYKCT 100
>EF2_NEUCR (Q96X45) Elongation factor 2 (EF-2) (Colonial temperature-sensitive| 3) Length = 844 Score = 28.9 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -2 Query: 246 FDRRYAGNHRAGIDRRQDGPAFQPGRRQRL 157 F R +AG R+G+ R GP + PG+++ L Sbjct: 398 FGRVFAGTVRSGLKVRIQGPNYTPGKKEDL 427
>CRLS1_HUMAN (Q9UJA2) Cardiolipin synthetase (EC 2.7.8.-) (Cardiolipin synthase)| (CLS) (Protein GCD10 homolog) Length = 301 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 154 PQTLSSARLKCWTILPPVNAC 216 P T S R CW +LPPV C Sbjct: 21 PGTRPSKRRACWALLPPVPCC 41
>KCNK4_HUMAN (Q9NYG8) Potassium channel subfamily K member 4 (TWIK-related| arachidonic acid-stimulated potassium channel protein) (TRAAK) (Two pore K(+) channel KT4.1) Length = 393 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 228 GNHRAGIDRRQDGPAFQP 175 G++ AG D RQD PA+QP Sbjct: 216 GDYVAGADPRQDSPAYQP 233
>LAMA2_HUMAN (P24043) Laminin alpha-2 chain precursor (Laminin M chain) (Merosin| heavy chain) Length = 3110 Score = 28.1 bits (61), Expect = 5.5 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 138 GFFACTSNVVVCPAEMLDHPASCQCLHDGYQHNVDQRCHG 257 G C + CP + + + C+C H+ + DQ C G Sbjct: 285 GMCICYGHARACPLDPATNKSRCECEHNTCGDSCDQCCPG 324
>PUNC_HUMAN (Q8IVU1) Putative neuronal cell adhesion molecule precursor| Length = 814 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 14/52 (26%) Frame = +3 Query: 90 LNTAQVVLLQSIMDHAGFFACTSN--------------VVVCPAEMLDHPAS 203 L T +++ + H+G + C +N VV PAE + HP S Sbjct: 287 LGTGNLIISDVTVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQS 338
>CLK2_HUMAN (P49760) Dual specificity protein kinase CLK2 (EC 2.7.12.1)| (CDC-like kinase 2) Length = 499 Score = 27.7 bits (60), Expect = 7.2 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 10/63 (15%) Frame = -2 Query: 339 RRSRAQSWLXRGFLDQHPRHNNSX----------RGYRRGIFDRRYAGNHRAGIDRRQDG 190 +R R++SW + R +S R R ++DRRY G++R R G Sbjct: 28 KRRRSRSWSSSSDRTRRRRREDSYHVRSRSSYDDRSSDRRVYDRRYCGSYRRNDYSRDRG 87 Query: 189 PAF 181 A+ Sbjct: 88 DAY 90
>PUNC_MOUSE (Q8BQC3) Putative neuronal cell adhesion molecule precursor| Length = 813 Score = 27.7 bits (60), Expect = 7.2 Identities = 14/52 (26%), Positives = 22/52 (42%), Gaps = 14/52 (26%) Frame = +3 Query: 90 LNTAQVVLLQSIMDHAGFFACTSN--------------VVVCPAEMLDHPAS 203 L T +++ + H+G + C +N VV PAE + HP S Sbjct: 299 LGTGNLIISDVTVQHSGVYVCAANRPGTRVRRTAQGRLVVQAPAEFVQHPQS 350
>TIMD4_HUMAN (Q96H15) T-cell immunoglobulin and mucin domain-containing protein| 4 precursor (TIMD-4) (T-cell membrane protein 4) (TIM-4) Length = 378 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 153 TSNVVVCPAEMLDHPASCQCLHDGYQHNVDQRCHG 257 TS VV E+L H + CL+ + HN + C G Sbjct: 23 TSETVV--TEVLGHRVTLPCLYSSWSHNSNSMCWG 55
>CU129_HUMAN (Q96M42) Protein C21orf129| Length = 142 Score = 27.7 bits (60), Expect = 7.2 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 109 CCFSQSWIMLASLRVPQTLSSARLK 183 CC+ Q+WI+ S + Q L+S+ L+ Sbjct: 65 CCYPQAWILACSAALLQALASSDLQ 89
>KIFC1_HUMAN (Q9BW19) Kinesin-like protein KIFC1 (Kinesin-like protein 2)| (Kinesin-related protein HSET) Length = 673 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 216 AGIDRRQDGPAFQPGRRQRLRYTQ 145 AG +R G A PG R+RLR TQ Sbjct: 567 AGSERLDPGLALGPGERERLRETQ 590
>RDRP_TNVA (P22958) RNA-directed RNA polymerase (EC 2.7.7.48) [Contains: 23| kDa protein] Length = 723 Score = 27.3 bits (59), Expect = 9.4 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 5/68 (7%) Frame = -2 Query: 282 HNNSXRGYRRGIFDRRYAGNHRAGIDRRQDGP-----AFQPGRRQRLRYTQRSQHDP*LT 118 HNNS RRG+ +R + + G + QD P AF+ + R YT+ S +T Sbjct: 252 HNNSLSNLRRGLMERVF---YVEGPNGLQDAPKPVKGAFRTLDKFRDLYTKNSWRHTPVT 308 Query: 117 EATLLVQY 94 L+ Y Sbjct: 309 SEQFLMNY 316
>GLGX_MYCTU (P0A4Y4) Glycogen operon protein glgX homolog (EC 3.2.1.-)| Length = 721 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 12 IVNRPXILILNHH*LFYKDSXAVCNKLNTAQVVLLQSIMDHAGFFACTSNV 164 I N +++H FYKD N LN LQ IMD ++ +V Sbjct: 306 IDNTAYYRLMDHDLRFYKDFTGTGNSLNARHPHTLQLIMDSLRYWVIEMHV 356
>GLGX_MYCBO (P0A4Y5) Glycogen operon protein glgX homolog (EC 3.2.1.-)| Length = 721 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = +3 Query: 12 IVNRPXILILNHH*LFYKDSXAVCNKLNTAQVVLLQSIMDHAGFFACTSNV 164 I N +++H FYKD N LN LQ IMD ++ +V Sbjct: 306 IDNTAYYRLMDHDLRFYKDFTGTGNSLNARHPHTLQLIMDSLRYWVIEMHV 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,245,200 Number of Sequences: 219361 Number of extensions: 870263 Number of successful extensions: 1980 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1886 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1977 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)