| Clone Name | rbaal16c21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CISH_HUMAN (Q9NSE2) Cytokine-inducible SH2-containing protein (C... | 28 | 8.4 | 2 | CISH_MOUSE (Q62225) Cytokine-inducible SH2-containing protein (C... | 28 | 8.4 | 3 | CISH_RAT (O70512) Cytokine-inducible SH2-containing protein (CIS... | 28 | 8.4 |
|---|
>CISH_HUMAN (Q9NSE2) Cytokine-inducible SH2-containing protein (CIS) (CIS-1)| (Suppressor of cytokine signaling) (SOCS) (Protein G18) Length = 258 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 120 DSLHPSQPASXPAKTTRPRYHXRIGYSTSSY 28 DS HPS + KTTR + RI Y+ SS+ Sbjct: 108 DSTHPSYLFTLSVKTTRGPTNVRIEYADSSF 138
>CISH_MOUSE (Q62225) Cytokine-inducible SH2-containing protein (CIS) (CIS-1)| (Suppressor of cytokine signaling) (SOCS) Length = 257 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 120 DSLHPSQPASXPAKTTRPRYHXRIGYSTSSY 28 DS HPS + KTTR + RI Y+ SS+ Sbjct: 108 DSTHPSYLFTLSVKTTRGPTNVRIEYADSSF 138
>CISH_RAT (O70512) Cytokine-inducible SH2-containing protein (CIS) (CIS-1)| (Suppressor of cytokine signaling) (SOCS) (Fragment) Length = 256 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 120 DSLHPSQPASXPAKTTRPRYHXRIGYSTSSY 28 DS HPS + KTTR + RI Y+ SS+ Sbjct: 107 DSTHPSYLFTLSVKTTRGPTNVRIEYADSSF 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,989,256 Number of Sequences: 219361 Number of extensions: 342506 Number of successful extensions: 676 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)