| Clone Name | rbaal6m14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AKAP6_RAT (Q9WVC7) A-kinase anchor protein 6 (Protein kinase A-a... | 28 | 5.5 | 2 | PCSK5_HUMAN (Q92824) Proprotein convertase subtilisin/kexin type... | 28 | 5.5 | 3 | HCN1_RABIT (Q9MZS1) Potassium/sodium hyperpolarization-activated... | 27 | 9.4 | 4 | YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'regio... | 27 | 9.4 |
|---|
>AKAP6_RAT (Q9WVC7) A-kinase anchor protein 6 (Protein kinase A-anchoring| protein 6) (PRKA6) (mAKAP) Length = 2314 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 9/49 (18%) Frame = +1 Query: 7 GEKITHTEQGCXQNTPRQHETGAATTPTR-RLHG--------ATSGKPR 126 G+ ++HT QGC ++T +G A R R+ G A S KP+ Sbjct: 2222 GDDVSHTSQGCAESTEPTTPSGKANAEGRSRMQGVSATPEENAASAKPK 2270
>PCSK5_HUMAN (Q92824) Proprotein convertase subtilisin/kexin type 5 precursor| (EC 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (PC6) (hPC6) Length = 913 Score = 28.1 bits (61), Expect = 5.5 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = -1 Query: 90 SRCCCRARLMLSWCVLSAALLGVCDLFSC 4 SRCCC RL L CVL ALLG C L C Sbjct: 5 SRCCCPGRLDL-LCVL--ALLGGCLLPVC 30
>HCN1_RABIT (Q9MZS1) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 1 (rbHCN1) Length = 822 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 43 QNTPRQHETGAATTPTRRLHGATSGKPRTS 132 Q P+Q +T + TP +H +T P TS Sbjct: 681 QQPPQQPQTPGSATPKNEVHRSTQALPNTS 710
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 14 RSHTPSRAADKTHHDSMRRARQQ--HRLGGYMVLHPASRAR 130 R H+ R HH RR R++ HR G HP R R Sbjct: 323 RPHSRKRRDTGAHHRHWRRRRRRVRHREGALPAAHPDDRRR 363 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,461,627 Number of Sequences: 219361 Number of extensions: 583436 Number of successful extensions: 1711 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1710 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)