| Clone Name | rbaal16b14 |
|---|---|
| Clone Library Name | barley_pub |
>INSR_DROME (P09208) Insulin-like receptor precursor (EC 2.7.10.1) (DIR) (DInr)| (dIRH) [Contains: Insulin-like receptor alpha subunit; Insulin-like receptor beta 1 subunit; Insulin-like receptor beta 2 subunit] Length = 2144 Score = 28.9 bits (63), Expect = 3.3 Identities = 24/77 (31%), Positives = 34/77 (44%), Gaps = 2/77 (2%) Frame = -1 Query: 248 LQAGCLLYEVANYAICRNIELIF*KLXKQTREWRNCIGTGSISS--LLPGSYTATDGIHS 75 L A C L+ N +C N +L K ++ R NCI + S L G +G S Sbjct: 508 LNASCQLHN--NRRLCWNSKLCQTKCPEKCRN--NCIDEHTCCSQDCLGGCVIDKNGNES 563 Query: 74 CILCNRNFFFILCL*AC 24 CI C F +C+ +C Sbjct: 564 CISCRNVSFNNICMDSC 580
>ZPBP1_PIG (Q29108) Zona pellucida-binding protein 1 precursor (Sp38)| Length = 350 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 110 PGSYTATDGIHSCILCNRNFFF 45 PG+Y + DGIH C+ CN + F Sbjct: 324 PGTYNSRDGIH-CLQCNSSLVF 344
>DNAA_SPICI (P34028) Chromosomal replication initiator protein dnaA| Length = 450 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +2 Query: 200 GKWHNSLLHTINNRLEEIYKTD 265 GK H LLH I N++ EIYKT+ Sbjct: 151 GKTH--LLHAIENKVNEIYKTN 170
>RRPL_HANTV (P23456) RNA-directed RNA polymerase (EC 2.7.7.48) (L protein)| Length = 2151 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +2 Query: 188 VLYSGKWHNSLLHTINNRLEEIYKTDV**WCIMSRRIREHAE 313 +L++G +N L + + + L+++YKTD MSR++R + + Sbjct: 991 MLHNGLPNNKLKNCVIDALKQVYKTDF----FMSRKLRNYID 1028
>ZPBP1_HUMAN (Q9BS86) Zona pellucida-binding protein 1 precursor (Sp38)| Length = 351 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 110 PGSYTATDGIHSCILCNRNFFF 45 PGSY DGIH C+ CN + + Sbjct: 325 PGSYNPRDGIH-CLQCNSSLVY 345
>M3LK7_DROME (P83104) Putative mitogen-activated protein kinase kinase kinase| 7-like (EC 2.7.11.25) Length = 393 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -2 Query: 262 CFVYFFKPVVYCMK*RIMPFAGI*NSSFRNYXSRPVSGATALELVLSRHCCQEVTQQLME 83 C VY F +++ + R +P++ + N + + + +S L + R C E +QLME Sbjct: 187 CDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEGIKQLME 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,385,658 Number of Sequences: 219361 Number of extensions: 816735 Number of successful extensions: 1765 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1765 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)