| Clone Name | rbaal16a16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y816_METJA (Q58226) Hypothetical protein MJ0816 | 30 | 9.0 | 2 | ARNA_SALTI (Q8Z540) Bifunctional polymyxin resistance arnA prote... | 30 | 9.0 | 3 | ARNA_SALPA (Q5PNA6) Bifunctional polymyxin resistance arnA prote... | 30 | 9.0 |
|---|
>Y816_METJA (Q58226) Hypothetical protein MJ0816| Length = 297 Score = 29.6 bits (65), Expect = 9.0 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = +1 Query: 85 RHLYSISYISLVCCYIAYFGMPNLPKSKKNTSMDIRIK*NLL-LPIASNIGQPKLVLRKF 261 + L+ I +C Y Y +PK KKN I + +L L I SNI K + F Sbjct: 101 KSLFDDEVIQDICNYFLY---RKIPKEKKNIICLIHCQYDLYALDILSNIFNVKAITYDF 157 Query: 262 PAHLTMKT 285 PA + KT Sbjct: 158 PALIPNKT 165
>ARNA_SALTI (Q8Z540) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 29.6 bits (65), Expect = 9.0 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 316 HHQLCQNLREFVGMQPVGIKCGSMVCLPYKQCCGTPHSR 432 HH+LCQ R+ + +KCG++ +P ++ T + R Sbjct: 162 HHKLCQAARQLLNSILPTMKCGNIPSVPQRESDATYYGR 200
>ARNA_SALPA (Q5PNA6) Bifunctional polymyxin resistance arnA protein [Includes:| UDP-glucuronic acid decarboxylase (EC 4.1.1.-) (UDP-GlcUA decarboxylase) (ArnAFT); UDP-4-amino-4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase Length = 660 Score = 29.6 bits (65), Expect = 9.0 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 316 HHQLCQNLREFVGMQPVGIKCGSMVCLPYKQCCGTPHSR 432 HH+LCQ R+ + +KCG++ +P ++ T + R Sbjct: 162 HHKLCQAARQLLNSILPTMKCGNIPSVPQRESDATYYGR 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,484,758 Number of Sequences: 219361 Number of extensions: 2207903 Number of successful extensions: 5645 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5645 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)