| Clone Name | rbaal15l16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_POWVL (Q04538) Genome polyprotein [Contains: Capsid protein... | 29 | 3.6 | 2 | SDHD_VIBPA (Q87QA2) Probable D-serine dehydratase (EC 4.3.1.18) ... | 28 | 6.1 |
|---|
>POLG_POWVL (Q04538) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3415 Score = 28.9 bits (63), Expect = 3.6 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 117 NMVVATYTSTVFWLSAVYLHLSFSTKSASKNLATNAHSLYASSKLVKNP 263 ++V AT TS ++ LHL+ T L AH + S+ +VKNP Sbjct: 2361 SLVGATPTSLALGVALAALHLAVVTSGLEAELTQRAHRAFFSA-MVKNP 2408
>SDHD_VIBPA (Q87QA2) Probable D-serine dehydratase (EC 4.3.1.18) (D-serine| deaminase) (DSD) Length = 443 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -2 Query: 114 VHCVICSPRRSSVLHLGIHATTGQEEAVRPI 22 VHC+ P S + LG+H E AV+ I Sbjct: 299 VHCIFAEPTHSPCMLLGVHTGLHDEIAVQDI 329 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,410,667 Number of Sequences: 219361 Number of extensions: 447243 Number of successful extensions: 1688 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1688 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)