| Clone Name | rbaal15k07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FOXL2_HUMAN (P58012) Forkhead box protein L2 | 26 | 5.5 | 2 | MNT_HUMAN (Q99583) Max-binding protein MNT (Protein ROX) (Myc an... | 25 | 8.8 | 3 | ATPA_CYAPA (P48080) ATP synthase alpha chain (EC 3.6.3.14) (ATP ... | 30 | 9.2 | 4 | YRSP_NEIGO (P72077) UPF0341 protein in rsp 3'region | 30 | 9.2 | 5 | Y1806_NEIMA (Q9JTE9) UPF0341 protein NMA1806 | 30 | 9.2 | 6 | Y1261_NEIG1 (Q5F7B7) UPF0341 protein NGO1261 | 30 | 9.2 |
|---|
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 25.8 bits (55), Expect(2) = 5.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 222 PHPHPHAIHTDRGGA 178 PHPHPHA H A Sbjct: 290 PHPHPHAHHLHAAAA 304 Score = 23.1 bits (48), Expect(2) = 5.5 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -1 Query: 258 GMSMPQILSTLDPHPHPH 205 G+ P PHPHPH Sbjct: 276 GLGGPPAAPPPPPHPHPH 293
>MNT_HUMAN (Q99583) Max-binding protein MNT (Protein ROX) (Myc antagonist MNT)| Length = 582 Score = 24.6 bits (52), Expect(2) = 8.8 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 303 PNLSVREGIEIVVSGGMSMPQILSTLDPHPHPH 205 P LS R E++ S + L PHPHPH Sbjct: 353 PKLSHRPQPELLKSTLPPPSTTPAPLPPHPHPH 385 Score = 23.5 bits (49), Expect(2) = 8.8 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -1 Query: 222 PHPHPHAI 199 PHPHPH++ Sbjct: 382 PHPHPHSV 389
>ATPA_CYAPA (P48080) ATP synthase alpha chain (EC 3.6.3.14) (ATP synthase F1| sector alpha subunit) Length = 505 Score = 29.6 bits (65), Expect = 9.2 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 15/143 (10%) Frame = -1 Query: 621 FMSSWVGASVLGIGEWIIKRMPLVRHIYN-------ASKQISAAISPDQNKQAFKEAVII 463 +++ + GAS I E+ + + IY+ A +Q+S + ++A+ V Sbjct: 237 YLAPYTGAS---IAEYFMYKGQHTLVIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFY 293 Query: 462 RHPRIGEYAF--------GFITSSVSLQSYSGQEDLYCVYVPTNHLYIGDIFMVNSKDVI 307 H R+ E A G +T+ +++ +G C Y+PTN + I D + S D+ Sbjct: 294 LHSRLLERAAKLSPQLGEGSMTALPIVETQAGD---VCAYIPTNVISITDGQIFLSADLF 350 Query: 306 RPNLSVREGIEIVVSGGMSMPQI 238 L + I VS S QI Sbjct: 351 NSGLRPAINVGISVSRVGSAAQI 373
>YRSP_NEIGO (P72077) UPF0341 protein in rsp 3'region| Length = 250 Score = 29.6 bits (65), Expect = 9.2 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 492 KQAFKEAVIIRHPRIGEYAFGFITSSVSLQSYSGQEDLYCVYVP 361 +Q K+ V+++ PR+GE+ G Y+G+ + VY+P Sbjct: 205 RQTAKKRVVVKRPRLGEHLAG----QAPAYQYTGKSTRFDVYLP 244
>Y1806_NEIMA (Q9JTE9) UPF0341 protein NMA1806| Length = 250 Score = 29.6 bits (65), Expect = 9.2 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 492 KQAFKEAVIIRHPRIGEYAFGFITSSVSLQSYSGQEDLYCVYVP 361 +Q K+ V+++ PR+GE+ G Y+G+ + VY+P Sbjct: 205 RQTAKKRVVVKRPRLGEHLAG----QAPAYQYTGKSTRFDVYLP 244
>Y1261_NEIG1 (Q5F7B7) UPF0341 protein NGO1261| Length = 250 Score = 29.6 bits (65), Expect = 9.2 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -1 Query: 492 KQAFKEAVIIRHPRIGEYAFGFITSSVSLQSYSGQEDLYCVYVP 361 +Q K+ V+++ PR+GE+ G Y+G+ + VY+P Sbjct: 205 RQTAKKRVVVKRPRLGEHLAG----QAPAYQYTGKSTRFDVYLP 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,899,364 Number of Sequences: 219361 Number of extensions: 2386970 Number of successful extensions: 6942 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6936 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)