| Clone Name | rbaal15j15 |
|---|---|
| Clone Library Name | barley_pub |
>ATG9_KLULA (Q6CT08) Autophagy-related protein 9| Length = 908 Score = 29.3 bits (64), Expect = 2.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 89 PTSLIRTCFLVQTLQWRFCIC 27 P L+RTC L +TL+W +C Sbjct: 455 PVPLLRTCALTKTLEWNINLC 475
>NUDH_BORPE (Q7VTZ7) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.8 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 36 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 137 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>NUDH_BORPA (Q7W482) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.8 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 36 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 137 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>NUDH_BORBR (Q7WFP0) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 190 Score = 29.3 bits (64), Expect = 2.8 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 5/39 (12%) Frame = +3 Query: 36 ESPLQC----LHQETGAD-QRSRVLGTAADKLKYTLTDH 137 ESP+Q LH+E G + R+LG D L+Y + DH Sbjct: 44 ESPVQAMYRELHEEVGLKPEHVRILGRTRDWLRYNVPDH 82
>HEMH_PSESM (Q888A2) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 340 Score = 28.5 bits (62), Expect = 4.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -3 Query: 104 CCTEYPTSLIRTCFLVQTLQWRFCICKNVNVP 9 CC P ++ TC+ Q LQ K + +P Sbjct: 211 CCMTAPAQVVATCYRAQCLQSAAAFAKRMGIP 242
>ZEST_DROVI (Q24762) Regulatory protein zeste| Length = 618 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 15 VNVFTNTESPLQCLHQETGADQRSRVLGTAADKLKYTLTDH 137 +N F E+ L+C Q+ + + L A D+LKY H Sbjct: 551 INYFKVKEAELRCKEQQLATEAKKIELNKAQDELKYMREVH 591 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,177,191 Number of Sequences: 219361 Number of extensions: 524097 Number of successful extensions: 1162 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1162 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)