| Clone Name | rbaal7b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUA1_XENLA (P10667) Integumentary mucin A.1 precursor (FIM-A.1) ... | 30 | 4.6 | 2 | CT096_HUMAN (Q9NUD7) Protein C20orf96 | 30 | 6.1 |
|---|
>MUA1_XENLA (P10667) Integumentary mucin A.1 precursor (FIM-A.1)| (Preprospasmolysin) Length = 400 Score = 30.0 bits (66), Expect = 4.6 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 390 TDDQKNDPEHLPTSDITPPCPRSEKELTKETITATHT 500 T + +P PT+D TPP E T ET T T T Sbjct: 247 TPETTTEPTTTPTTDTTPPTLPPTPETTTETTTETTT 283
>CT096_HUMAN (Q9NUD7) Protein C20orf96| Length = 363 Score = 29.6 bits (65), Expect = 6.1 Identities = 16/65 (24%), Positives = 26/65 (40%) Frame = +3 Query: 96 RPGTHPRSXXXXXXXLQMNNQRARVK*PLHVPATGVVVICEPQGTQQSHFQRYQD*QSLM 275 +P T P RV+ H T VV C+P+ ++ H +R D + Sbjct: 36 KPSTLPPVQQANSLHTSKMKTLTRVQPVFHFKPTTVVTSCQPKNPRELHRRRKLDPGKMH 95 Query: 276 GEVWL 290 ++WL Sbjct: 96 AKIWL 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,549,437 Number of Sequences: 219361 Number of extensions: 1180627 Number of successful extensions: 2437 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2436 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)