ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal14n21 |
|---|---|
| Clone Library Name | barley_pub |
>CLIC1_MOUSE (Q9Z1Q5) Chloride intracellular channel protein 1 (Nuclear chloride| ion channel 27) (NCC27) Length = 240 Score = 32.7 bits (73), Expect = 0.71 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 414 FKGWKVPETLTSVHAYTEALFSRESFVKTKPTKENL 307 ++G+ +PE VH Y ++RE F T P E + Sbjct: 193 YRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEI 228
>CLIC1_HUMAN (O00299) Chloride intracellular channel protein 1 (Nuclear chloride| ion channel 27) (NCC27) (Chloride channel ABP) (Regulatory nuclear chloride ion channel protein) (hRNCC) Length = 240 Score = 32.7 bits (73), Expect = 0.71 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -2 Query: 414 FKGWKVPETLTSVHAYTEALFSRESFVKTKPTKENL 307 ++G+ +PE VH Y ++RE F T P E + Sbjct: 193 YRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEI 228
>CLIC1_RABIT (Q95MF9) Chloride intracellular channel protein 1| Length = 240 Score = 31.6 bits (70), Expect = 1.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 411 KGWKVPETLTSVHAYTEALFSRESFVKTKPTKENL 307 +G+ +PE VH Y ++RE F T P E + Sbjct: 194 RGFTIPEVFRGVHRYLSNAYAREEFASTCPDDEEI 228
>ACES_HUMAN (P22303) Acetylcholinesterase precursor (EC 3.1.1.7) (AChE)| Length = 614 Score = 31.6 bits (70), Expect = 1.6 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 539 RAAGTGRAPKGPWTLYQRGECLRRGSQLGSEALPPPG 429 RA AP GPW GE RR +QL PPG Sbjct: 255 RAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPG 291
>GIDB_BACHK (Q6HAF4) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 239 Score = 30.8 bits (68), Expect = 2.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 344 SRLKRASV*AWTLVSVSGTFQPLKCSRGNLEVEELRSQAEIRGGDIR 484 +RL S LV V GTF +K + N E+E + E+ GGD++ Sbjct: 150 ARLSVLSELCLPLVKVGGTFIAMKGAAANEEIENGKYALEVLGGDLK 196
>GIDB_BACC1 (Q72WU5) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 239 Score = 30.8 bits (68), Expect = 2.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 344 SRLKRASV*AWTLVSVSGTFQPLKCSRGNLEVEELRSQAEIRGGDIR 484 +RL S LV V GTF +K + N E+E + E+ GGD++ Sbjct: 150 ARLSVLSELCLPLVKVGGTFIAMKGAAANEEIENGKYALEVLGGDLK 196
>GIDB_BACAN (Q81JH4) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 239 Score = 30.8 bits (68), Expect = 2.7 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +2 Query: 344 SRLKRASV*AWTLVSVSGTFQPLKCSRGNLEVEELRSQAEIRGGDIR 484 +RL S LV V GTF +K + N E+E + E+ GGD++ Sbjct: 150 ARLSVLSELCLPLVKVGGTFIAMKGAAANEEIENGKYALEVLGGDLK 196
>SPTN2_RAT (Q9QWN8) Spectrin beta chain, brain 2 (Spectrin, non-erythroid beta| chain 2) (Beta-III spectrin) (SPNB-3) (Beta SpIII sigma 1) (Spectrin-like protein GTRAP41) Length = 2388 Score = 30.4 bits (67), Expect = 3.5 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = -1 Query: 553 KALVDELQALEEHLKAHGPYINGANVSAADLSLAPKLFHLQVAPGALQRLE 401 +AL + +ALEE ++AH P ++ AA +L P L H G + LE Sbjct: 783 QALARQHRALEEEIRAHRPTLDALREQAA--ALPPALSHTPEVQGRVPTLE 831
>ACPS_DESDG (Q30ZQ5) Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7)| (Holo-ACP synthase) (4'-phosphopantetheinyl transferase acpS) Length = 123 Score = 30.0 bits (66), Expect = 4.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 346 AAEESLGVGMDAGQCFRDLPAFEVLQGQP 432 AA ++LG G G FRD+ ++ L G+P Sbjct: 56 AAAKALGTGFTGGVAFRDIEVYKELSGKP 84
>MAAI_CAEEL (Q18938) Probable maleylacetoacetate isomerase (EC 5.2.1.2) (MAAI)| Length = 214 Score = 30.0 bits (66), Expect = 4.6 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 6/48 (12%) Frame = -1 Query: 547 LVDELQALEEHLKAH-GPYINGANVSAADLSLAPKL-----FHLQVAP 422 +V+ L ALE LK H G Y G +V+ ADLS+ P + F+L ++P Sbjct: 135 VVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSANRFNLDLSP 182
>ACES_RABIT (Q29499) Acetylcholinesterase precursor (EC 3.1.1.7) (AChE)| (Fragment) Length = 584 Score = 30.0 bits (66), Expect = 4.6 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 539 RAAGTGRAPKGPWTLYQRGECLRRGSQLGSEALPPPG 429 RA AP GPW GE RR + L + PPG Sbjct: 225 RAVLQSGAPNGPWATVGVGEARRRATLLARLVVCPPG 261
>FRAS1_MOUSE (Q80T14) Extracellular matrix protein FRAS1 precursor| Length = 4010 Score = 29.6 bits (65), Expect = 6.0 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = -1 Query: 178 GFGIMRASLCCVXCLSQARTC-----CVDCLPP 95 G G +A C+ C Q TC C CLPP Sbjct: 454 GLGFYQAGSLCLACQPQCSTCTNGLECSSCLPP 486
>GSTA3_MOUSE (P30115) Glutathione S-transferase Yc (EC 2.5.1.18) (GST| class-alpha) (Ya3) Length = 220 Score = 29.6 bits (65), Expect = 6.0 Identities = 16/41 (39%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = -1 Query: 529 ALEEHLKAHGP-YINGANVSAADLSLAPKLFHL-QVAPGAL 413 A E+ LK+HG Y+ G +S AD++L L+H+ ++ PG + Sbjct: 134 AFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVV 174
>GIDB_BACCR (Q814F8) Methyltransferase gidB (EC 2.1.-.-) (Glucose-inhibited| division protein B) Length = 239 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 344 SRLKRASV*AWTLVSVSGTFQPLKCSRGNLEVEELRSQAEIRGGDIR 484 +RL S LV V GTF +K + N E+E + E+ GG+++ Sbjct: 150 ARLSVLSELCLPLVKVGGTFIAMKGAAANEEIENGKYALEVLGGELK 196
>AMC1_ORYSA (P27940) Alpha-amylase isozyme C (EC 3.2.1.1) (1,4-alpha-D-glucan| glucanohydrolase) (Isozyme 1B) Length = 348 Score = 29.3 bits (64), Expect = 7.9 Identities = 23/77 (29%), Positives = 32/77 (41%), Gaps = 3/77 (3%) Frame = +3 Query: 258 RRAGELTGSPSAPTRRSGSPWSAWS*RTTRG-*REPRCRHGRW--SVFQGPSSL*SAPGA 428 RR + S S+ + +GS S W+ +TRG PR W S PS P Sbjct: 158 RRTSTTSTSASSGSSSAGSTGSRWTSASTRGASTSPRATPPTWQRSTSMPPSRASPWPRY 217 Query: 429 TWRWKSFGAKLRSAAET 479 RW++ G R+ T Sbjct: 218 GRRWRTAGTASRTTTRT 234
>GSTZ1_DIACA (P28342) Glutathione S-transferase 1 (EC 2.5.1.18) (SR8) (GST| class-zeta) Length = 221 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 529 ALEEHLKAH-GPYINGANVSAADLSLAPKL 443 ALE+ LK H G Y G V ADL LAP++ Sbjct: 146 ALEKLLKGHAGKYATGDEVGLADLFLAPQI 175
>CF150_HUMAN (Q8N884) Protein C6orf150| Length = 522 Score = 29.3 bits (64), Expect = 7.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 Query: 497 LYQRGECLRRGSQLGSEALPPPGCPWSTSKAG 402 L + G C +RG++ ++ PPPG PW G Sbjct: 115 LSRAGSCRQRGARCSTKPRPPPG-PWDVPSPG 145
>CD1B_HUMAN (P29016) T-cell surface glycoprotein CD1b precursor (CD1b antigen)| Length = 333 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = -3 Query: 527 TGRAPKGPWTLYQRGECLRRGSQLGSEALPPPGCPW 420 +G PK W ++ RGE ++G+QLG + LP W Sbjct: 227 SGFYPKPVWVMWMRGEQEQQGTQLG-DILPNANWTW 261
>RT18B_HUMAN (Q9Y676) 28S ribosomal protein S18b, mitochondrial precursor| (MRP-S18-b) (Mrps18b) (MRP-S18-2) Length = 258 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +3 Query: 195 QATDEALLL---PSLLAQRVVFSERRAGELTGSPSAPTRRSGSPWSAW 329 +A D LL+ P + + + FS G ++ +P APT SG PW W Sbjct: 156 KARDHGLLIYHIPQVEPRDLDFSTSH-GAVSATPPAPTLVSGDPWYPW 202
>EDN2_HUMAN (P20800) Endothelin-2 precursor (ET-2) (Preproendothelin-2) (PPET2)| Length = 178 Score = 29.3 bits (64), Expect = 7.9 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = +3 Query: 207 EALLLPSLLAQRVVFSERRAGELTGSPSAPTRRSGSPWSAWS*RTTRG*REPRCRHGRW 383 EA +PS + VF + G TG R + S ++ R REPR H RW Sbjct: 117 EAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRW 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,572,612 Number of Sequences: 219361 Number of extensions: 1377941 Number of successful extensions: 4754 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 4547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4754 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
