| Clone Name | rbaal15b02 |
|---|---|
| Clone Library Name | barley_pub |
>Y334_BUCBP (Q89AG0) Hypothetical UPF0076 protein bbp_334| Length = 126 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +3 Query: 66 YNFLRGILSSTNNLQQHLFFQPSIHTINIRTMLDVKELH 182 + FL G +S T+N+ ++ FQ NI +L+ KE++ Sbjct: 26 FTFLSGQISQTDNINTNISFQTQSILQNINYILESKEMN 64
>Y2392_ARCFU (O30279) Hypothetical protein AF2392| Length = 86 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 180 HRLTPIPGAMG---WMQETHDWDWHPPCPYRPS 269 +R T +PG M W H WD+ P PY P+ Sbjct: 17 YRATGLPGWMRCRWWGYRDHPWDYPPYPPYPPA 49
>AGT2_RAT (Q64565) Alanine--glyoxylate aminotransferase 2, mitochondrial| precursor (EC 2.6.1.44) ((R)-3-amino-2-methylpropionate--pyruvate transaminase) (EC 2.6.1.40) (AGT 2) (Beta-alanine-pyruvate aminotransferase) (Beta-ALAAT II) (D-AIBAT) Length = 512 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 175 NYTD*LQFRGQWDGCRKLTIGI 240 N+TD + FRG + GC T+G+ Sbjct: 184 NHTDIISFRGAYHGCSPYTLGL 205
>GPI8_PONPY (Q5R6L8) GPI-anchor transamidase precursor (EC 3.-.-.-) (GPI| transamidase) (Phosphatidylinositol-glycan biosynthesis, class K protein) (PIG-K) Length = 395 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 40 KLYDSHPPATIFSGVF*VLLIIYNSTYSFNH 132 KL D HPP G++ ++++++ TY H Sbjct: 360 KLKDWHPPGGFILGLWALIIMVFFKTYGIKH 390
>GPI8_PIG (Q4KRV1) GPI-anchor transamidase precursor (EC 3.-.-.-) (GPI| transamidase) (Phosphatidylinositol-glycan biosynthesis, class K protein) (PIG-K) Length = 395 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 40 KLYDSHPPATIFSGVF*VLLIIYNSTYSFNH 132 KL D HPP G++ ++++++ TY H Sbjct: 360 KLKDWHPPGGFILGLWALIIMVFFKTYGIKH 390
>GPI8_HUMAN (Q92643) GPI-anchor transamidase precursor (EC 3.-.-.-) (GPI| transamidase) (Phosphatidylinositol-glycan biosynthesis, class K protein) (PIG-K) (hGPI8) Length = 395 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 40 KLYDSHPPATIFSGVF*VLLIIYNSTYSFNH 132 KL D HPP G++ ++++++ TY H Sbjct: 360 KLKDWHPPGGFILGLWALIIMVFFKTYGIKH 390
>GPI8_BOVIN (Q3MHZ7) GPI-anchor transamidase precursor (EC 3.-.-.-) (GPI| transamidase) (Phosphatidylinositol-glycan biosynthesis, class K protein) (PIG-K) Length = 395 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 40 KLYDSHPPATIFSGVF*VLLIIYNSTYSFNH 132 KL D HPP G++ ++++++ TY H Sbjct: 360 KLKDWHPPGGFILGLWALIIMVFFKTYGIKH 390
>O52L2_HUMAN (Q8NGH6) Olfactory receptor 52L2| Length = 304 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 214 HPIAPGIGVNRCNSLTSNMVLIFIVWMD 131 H IA +G+ +L N+ ++FI+WMD Sbjct: 28 HWIALPLGILYLLALVGNVTILFIIWMD 55
>O52L1_HUMAN (Q8NGH7) Olfactory receptor 52L1| Length = 314 Score = 27.7 bits (60), Expect = 8.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 214 HPIAPGIGVNRCNSLTSNMVLIFIVWMD 131 H IA +G+ +L N+ ++FI+WMD Sbjct: 28 HWIALPLGILYLLALVGNVTILFIIWMD 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,482,055 Number of Sequences: 219361 Number of extensions: 850404 Number of successful extensions: 1906 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1873 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1905 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)