| Clone Name | rbaal14l20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HEM0_BRARE (Q9YHT4) 5-aminolevulinate synthase, erythroid-specif... | 30 | 3.7 | 2 | RB97D_DROME (Q02926) Ribonucleoprotein RB97D | 30 | 4.9 | 3 | TECTA_HUMAN (O75443) Alpha-tectorin precursor | 29 | 6.4 |
|---|
>HEM0_BRARE (Q9YHT4) 5-aminolevulinate synthase, erythroid-specific,| mitochondrial precursor (EC 2.3.1.37) (5-aminolevulinic acid synthase) (Delta-aminolevulinate synthase) (Delta-ALA synthetase) (ALAS-E) Length = 583 Score = 30.0 bits (66), Expect = 3.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 341 NFENQQASSMFQDQFFCTRNDQSSGETHLFRD 246 N ENQ S + F ++ QS+G THL +D Sbjct: 100 NLENQDTSGLISSLFSGLQSHQSTGPTHLLQD 131
>RB97D_DROME (Q02926) Ribonucleoprotein RB97D| Length = 471 Score = 29.6 bits (65), Expect = 4.9 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 248 PEIGEFHPNFGHSLCRRTGPGTWNWLADFRSCSSPIYQQVTLMQ 379 P +G P GH+ T PG WN + P +QQ + Q Sbjct: 337 PPVGAVPPPMGHNGPPPTAPGNWNMPPPVPGAAPPSHQQQSSQQ 380
>TECTA_HUMAN (O75443) Alpha-tectorin precursor| Length = 2155 Score = 29.3 bits (64), Expect = 6.4 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 12/64 (18%) Frame = +2 Query: 197 LQSAIQAFSLITSG*GSPEIGEFH-----------PNFGH-SLCRRTGPGTWNWLADFRS 340 L AIQA++L+ G P IG++ P+F H S+C + P T + L R+ Sbjct: 564 LCQAIQAYALVCQALGIP-IGDWRTQTGCVSTVQCPSFSHYSVCTSSCPDTCSDLTASRN 622 Query: 341 CSSP 352 C++P Sbjct: 623 CATP 626 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,388,539 Number of Sequences: 219361 Number of extensions: 1210565 Number of successful extensions: 2502 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2502 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)