| Clone Name | rbaal14k03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRPV4_RAT (Q9ERZ8) Transient receptor potential cation channel s... | 28 | 4.4 | 2 | YME3_YEAST (Q04712) Hypothetical 59.3 kDa protein in PRP39-CAT2 ... | 28 | 5.7 | 3 | PRP5_CRYNE (Q5KME7) Pre-mRNA-processing ATP-dependent RNA helica... | 27 | 9.8 |
|---|
>TRPV4_RAT (Q9ERZ8) Transient receptor potential cation channel subfamily V| member 4 (TrpV4) (osm-9-like TRP channel 4) (OTRPC4) (Vanilloid receptor-related osmotically-activated channel) (VR-OAC) Length = 871 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 5/37 (13%) Frame = +3 Query: 57 AYKIHHRRRR-----HHPSTGKT*LPRHSNTNLSNGR 152 +Y + H++R PSTGKT LP+ + NLSNGR Sbjct: 171 SYLLTHKKRLTDEEFREPSTGKTCLPK-ALLNLSNGR 206
>YME3_YEAST (Q04712) Hypothetical 59.3 kDa protein in PRP39-CAT2 intergenic| region Length = 507 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 22 PIXNSRHEIRNGHTRFIIVVVVIIHLQ-AKHN 114 P+ S E+RN TR I+ + ++HL ++HN Sbjct: 197 PLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHN 228
>PRP5_CRYNE (Q5KME7) Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (EC| 3.6.1.-) Length = 1072 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 16 VAPIXNSRHEIRNGHTRFIIVVVVIIHLQAKHNSQD 123 VAP + R E+R+G T+F ++ ++ + +H +D Sbjct: 620 VAPEIDQRVEVRDGDTKFTRLLEILGEMGEEHKDED 655 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,483,707 Number of Sequences: 219361 Number of extensions: 737278 Number of successful extensions: 1645 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1644 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)