| Clone Name | rbaal14g20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NPC2_CAEEL (P34389) Niemann-Pick C1 protein homolog 2 precursor | 28 | 6.7 |
|---|
>NPC2_CAEEL (P34389) Niemann-Pick C1 protein homolog 2 precursor| Length = 1274 Score = 28.1 bits (61), Expect = 6.7 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = -3 Query: 173 MHACILPSYRQRINLSTTCYXSY-------FILPSLFCKTRTYVRFYTTLCALSSVIHVI 15 +++ P Y Q + LSTT Y F+ SLF + T LSS +H++ Sbjct: 1064 VYSTFFPYYEQYLTLSTTVYTLVVLVLFVAFVTISLFLRVNLAGSLVTVFVLLSSYLHLM 1123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,907,656 Number of Sequences: 219361 Number of extensions: 402210 Number of successful extensions: 783 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)