| Clone Name | rbaal14e03 |
|---|---|
| Clone Library Name | barley_pub |
>RYR1_RABIT (P11716) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5037 Score = 32.0 bits (71), Expect = 0.98 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 186 CRILPRWWRTGACSPPPA 239 C LPRWW G +PPPA Sbjct: 3278 CSYLPRWWERGPEAPPPA 3295
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 32.0 bits (71), Expect = 0.98 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 186 CRILPRWWRTGACSPPPA 239 C LPRWW G +PPPA Sbjct: 3279 CSYLPRWWERGPEAPPPA 3296
>CAC1H_HUMAN (O95180) Voltage-dependent T-type calcium channel alpha-1H subunit| (Voltage-gated calcium channel alpha subunit Cav3.2) (Low-voltage-activated calcium channel alpha1 3.2 subunit) Length = 2353 Score = 31.2 bits (69), Expect = 1.7 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -3 Query: 281 SPGGSASLSTVTSL--SWRGRASSGTPPSGEY-PTSSFRSCCCYGW 153 +P S L SL S RG +SSG PP G+ P +S RS C W Sbjct: 1087 TPKSSPFLDAAPSLPDSRRGSSSSGDPPLGDQKPPASLRSSPCAPW 1132
>EGF_MOUSE (P01132) Pro-epidermal growth factor precursor (EGF) [Contains:| Epidermal growth factor] Length = 1217 Score = 31.2 bits (69), Expect = 1.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 207 WRTGACSPPPAQRSHRRQTC*TP 275 W+TG C P P +RS R TC P Sbjct: 29 WQTGNCQPGPLERSERSGTCAGP 51
>VSX1_MOUSE (Q91V10) Visual system homeobox 1 (Transcription factor VSX1)| (Retinal inner nuclear layer homeobox protein) (Homeodomain protein RINX) Length = 363 Score = 29.3 bits (64), Expect = 6.4 Identities = 22/61 (36%), Positives = 27/61 (44%), Gaps = 11/61 (18%) Frame = +3 Query: 108 AIPYHHCILFGFFTVPPVAAARSEGRC------RILPRWW-----RTGACSPPPAQRSHR 254 A+P +L GF PP AAA + RC R+LP G PPPA S + Sbjct: 81 ALPLGLGLLCGFGAQPPSAAAAARARCLLLADLRLLPSAGPEPAVAQGPVHPPPALGSQQ 140 Query: 255 R 257 R Sbjct: 141 R 141
>SEC1_YEAST (P30619) Protein transport protein SEC1| Length = 724 Score = 29.3 bits (64), Expect = 6.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 5 WFDLXSQHLAQQNKQIKGRXAELXSRS 85 W DL QH+ N+ I+GR EL +++ Sbjct: 310 WIDLKHQHIMDANEYIQGRIKELIAKN 336
>RYR1_HUMAN (P21817) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5038 Score = 28.9 bits (63), Expect = 8.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 186 CRILPRWWRTGACSPPPA 239 C LPRWW G +PP A Sbjct: 3278 CSYLPRWWERGPEAPPSA 3295
>CJ095_HUMAN (Q9H7T3) Protein C10orf95| Length = 257 Score = 28.9 bits (63), Expect = 8.3 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +3 Query: 216 GAC----SPPPAQRSHRRQTC*TPRRAIPRSCTRRRAASSPQSA 335 G+C +P PA TC +P A C RRRA SSP +A Sbjct: 189 GSCGARTAPTPAP------TCASPSAAASSCCRRRRACSSPTTA 226
>PUR5_THEVO (Q97CD7) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 338 Score = 28.9 bits (63), Expect = 8.3 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -2 Query: 351 GEGLRSLIAVRMLHDDGYKNVGWLAGGFSKSVD-GDFA 241 GE + S I H + +KN+G++ GGF+ +D G+FA Sbjct: 15 GEFVSSFIRQLKFHREDFKNIGYI-GGFTSLIDMGNFA 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,453,221 Number of Sequences: 219361 Number of extensions: 1211844 Number of successful extensions: 3650 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3648 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)